KEGG   Natronococcus occultus: Natoc_0195Help
Entry
Natoc_0195        CDS       T02426                                 

Definition
protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nou  Natronococcus occultus
Brite
Enzymes [BR:nou01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Natoc_0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
189265..190008
Genome map
AA seq 247 aa AA seqDB search
MDPAVLREDMVDGLESPTKVALDDEAVAIAMRDVPRHEFLEDDHAAYADRAHEVLETRVL
APSTVAQLFEALAIENGDDVLIVGAGIGYTAAVAAEIVGEHRVHAVDISRPLVYAARTNL
ERAGYQGVLVDRRDGAGGLPEYAPFDRILLEAAAVDPPRALLAQLADGGRLVLPRGTQPQ
RITAVDPDGSSDEFGVVSFDPLLLEGEQSGAVERNRTDREDVEYARRRADSRTGWEQEWI
EWDDRLR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggaccctgcggtactgcgggaagatatggtcgacggcctcgagtcgccgaccaaggtg
gccctcgacgacgaggccgtcgccatcgccatgcgtgacgtcccccgtcacgagttcctc
gaggacgaccacgctgcctacgccgatcgagcacacgaggtcctcgagacccgcgtcctc
gcaccgagtacggtcgcccagctgttcgaagcgctcgcgatcgagaacggcgacgacgtg
ttgatcgtcggcgccgggatcggctacacggcagcggtagcagccgagatcgtcggcgag
caccgcgttcacgccgtcgatatctcgcggccgctggtctacgcggcccggaccaacctc
gagcgagcggggtaccagggcgtcctcgtcgatcgtcgcgacggcgccggcggacttccc
gagtacgcccccttcgatcggatcctcctcgaggcagccgcggtcgatccgccccgcgcg
ctgctggcccagctcgcggacggcggccgtctcgttctccctcgcgggacccagccacag
cggatcacggccgtcgatcccgacggctcgagcgacgagttcggcgtcgtctcgttcgat
ccgctcctgctggagggcgagcagtccggcgccgtcgagcgcaaccgaaccgatcgcgag
gacgtcgagtacgcccgccgccgggcggactcgcgaacgggctgggaacaggagtggatc
gagtgggacgatcggctccgctga

DBGET integrated database retrieval system