KEGG   Natronococcus occultus: Natoc_0400Help
Entry
Natoc_0400        CDS       T02426                                 

Definition
sugar kinase, ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nou  Natronococcus occultus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Natoc_0400
Enzymes [BR:nou01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Natoc_0400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(392511..393410)
Genome map
AA seq 299 aa AA seqDB search
MVTVLTAGHVNWDVTLRIDRFPAADGEASIRSQRQSGGGSAANVAATLAGLEVDVGLIGS
VGDDDNGLLARHELEETGVSIDGVRIVEDADTAVKYLLVEDSGEVAVLGNDGVNEAVGPE
DLEPERIRASSHVHLTSQRPDTAAEIASIASEADVTVSFDPGRRLGDRDYGDALALADVI
FVNDREAETMLEDEYSASTFDDRLVVVKHGADGALVHAPDGDRVHPGFEVETVDTAGAGD
AFAAGFLATMIDGDRNGDGVDLDRALEYANACGALTAGREGARNVPSAAEVTAFLSERH
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggttaccgtcctcactgcgggtcacgtcaactgggacgtgacgttgcgcatcgatcga
tttccggctgccgacggcgaggcgtcgatccgctcgcagcgacagtccggcggcggcagc
gccgcgaacgtcgccgcgacgctggccggactcgaggtcgacgtcgggctcatcgggagc
gtcggcgacgacgacaacggactgttggcccgccacgagctcgaggagaccggagtctcg
atcgacggcgtgcggatcgtcgaggacgccgatacggcggtgaagtacctgctggtcgaa
gacagcggggaggtcgccgtactcggaaacgacggcgtcaacgaggccgtcggtccggag
gatctcgagcccgagcggatccgggcgtcgagtcacgtccatctgacgagccaacgaccc
gacactgccgccgagatcgcgtccatcgcgagcgaggccgacgtcactgtcagcttcgat
ccggggcgtcggctcggcgatcgggactacggcgacgcgctcgcgctcgcggacgtgatc
ttcgtcaacgatcgcgaggccgagacgatgctcgaagacgagtacagcgcgtcgacgttc
gacgatcgactcgtcgtcgtcaaacacggcgccgacggcgccctggtccacgcacccgac
ggcgaccgcgtccaccccgggttcgaggtcgagacggtcgacaccgcgggtgccggtgac
gccttcgcggccggctttctcgcgacgatgatcgacggcgaccggaacggggacggagtc
gacctcgaccgggcgctcgagtacgccaacgcctgcggtgcgctgacggccggacgagag
ggtgcacgcaacgttccgtcggccgccgaagttacggcgtttctcagtgagcgtcactga

DBGET integrated database retrieval system