KEGG   Natronococcus occultus: Natoc_0547Help
Entry
Natoc_0547        CDS       T02426                                 

Definition
peptidase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
nou  Natronococcus occultus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Natoc_0547
Enzymes [BR:nou01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Natoc_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
527813..528880
Genome map
AA seq 355 aa AA seqDB search
MKSAPFDTELLETLTETSGVPGYEDRVRELVVEELEDSVDRVRTDAMGNVVGTLEGDGEY
SVAVAAHMDEIGFMVRNVRGEDDGFGFVELDALGGWDARVLTAQRVMIHTEDGDVPGVIG
SPPPHTLDEEEREKTPEVEDVAVDVGLPYEEADERISPGDLVTMDQTTERVGETITGKAL
DDRVCLFAMLEAARRLEAPDATIHFCATVQEEVGLRGANALGVDVDPDLAVALDVTVAND
LPEFDDGEHVTELGEGTAIKLKDSSVITNPKVHRRMQAVADERGIDHQLEILPAGGTDTA
GFQNTAGAKPVGAISVPTRYLHTVTETAHVDDIAATIDLLEAFLETEDGDHEYTF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccgccccgttcgacaccgagcttctggagacgctcaccgaaaccagcggcgtc
cccggctacgaggatcgcgtgcgcgaactcgtcgtcgaagaactcgaggacagcgtcgat
cgggtccgaaccgacgcgatgggtaacgtcgttggcacgctcgagggcgacggggagtac
tcggtcgccgtcgccgcccacatggacgagatcggcttcatggttcgcaacgtccgcggc
gaggacgacggcttcggcttcgtcgagctcgatgcgctgggcgggtgggacgcccgcgtg
ctcacggcccagcgggtgatgatccacaccgaggacggcgatgttccgggcgtcatcggt
tcgcctccgcctcacaccctggacgaggaggaacgcgagaagaccccggaggtcgaggac
gtcgctgtcgacgtcggtctcccctacgaggaggccgacgagcggatctcgccgggcgat
ctggtcacgatggatcagaccaccgagcgtgtcggcgagacgatcacggggaaggccctg
gacgaccgggtctgtctgttcgcgatgctcgaggccgcccgccgcctcgaggcgcccgac
gcgacgatccacttctgtgcgacagttcaggaggaggttgggctccgcggcgcgaacgcg
ctgggcgtcgacgtcgaccccgacctcgcggtcgcgctcgacgtcaccgtcgccaacgac
ctccccgagttcgacgacggcgaacacgtcaccgaactcggtgagggaaccgcgatcaag
ctcaaggattcgagcgtcatcacgaacccgaaggtccaccgtcggatgcaggccgtcgcc
gacgagcgggggatcgaccaccagctcgagatcctgcccgcgggcggcaccgacaccgcc
ggcttccaaaacaccgccggcgcaaaacccgtcggcgcgatctcggttccgacgcggtat
ctccacaccgtcaccgagaccgcccacgtcgacgatatcgcggccaccatcgacctgctc
gaggcgttcctcgagaccgaggacggcgaccacgagtacacgttctag

DBGET integrated database retrieval system