KEGG   Natronococcus occultus: Natoc_0547Help
Entry
Natoc_0547        CDS       T02426                                 

Definition
(GenBank) peptidase family protein
Organism
nou  Natronococcus occultus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
527813..528880
Genome map
AA seq 355 aa AA seqDB search
MKSAPFDTELLETLTETSGVPGYEDRVRELVVEELEDSVDRVRTDAMGNVVGTLEGDGEY
SVAVAAHMDEIGFMVRNVRGEDDGFGFVELDALGGWDARVLTAQRVMIHTEDGDVPGVIG
SPPPHTLDEEEREKTPEVEDVAVDVGLPYEEADERISPGDLVTMDQTTERVGETITGKAL
DDRVCLFAMLEAARRLEAPDATIHFCATVQEEVGLRGANALGVDVDPDLAVALDVTVAND
LPEFDDGEHVTELGEGTAIKLKDSSVITNPKVHRRMQAVADERGIDHQLEILPAGGTDTA
GFQNTAGAKPVGAISVPTRYLHTVTETAHVDDIAATIDLLEAFLETEDGDHEYTF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccgccccgttcgacaccgagcttctggagacgctcaccgaaaccagcggcgtc
cccggctacgaggatcgcgtgcgcgaactcgtcgtcgaagaactcgaggacagcgtcgat
cgggtccgaaccgacgcgatgggtaacgtcgttggcacgctcgagggcgacggggagtac
tcggtcgccgtcgccgcccacatggacgagatcggcttcatggttcgcaacgtccgcggc
gaggacgacggcttcggcttcgtcgagctcgatgcgctgggcgggtgggacgcccgcgtg
ctcacggcccagcgggtgatgatccacaccgaggacggcgatgttccgggcgtcatcggt
tcgcctccgcctcacaccctggacgaggaggaacgcgagaagaccccggaggtcgaggac
gtcgctgtcgacgtcggtctcccctacgaggaggccgacgagcggatctcgccgggcgat
ctggtcacgatggatcagaccaccgagcgtgtcggcgagacgatcacggggaaggccctg
gacgaccgggtctgtctgttcgcgatgctcgaggccgcccgccgcctcgaggcgcccgac
gcgacgatccacttctgtgcgacagttcaggaggaggttgggctccgcggcgcgaacgcg
ctgggcgtcgacgtcgaccccgacctcgcggtcgcgctcgacgtcaccgtcgccaacgac
ctccccgagttcgacgacggcgaacacgtcaccgaactcggtgagggaaccgcgatcaag
ctcaaggattcgagcgtcatcacgaacccgaaggtccaccgtcggatgcaggccgtcgcc
gacgagcgggggatcgaccaccagctcgagatcctgcccgcgggcggcaccgacaccgcc
ggcttccaaaacaccgccggcgcaaaacccgtcggcgcgatctcggttccgacgcggtat
ctccacaccgtcaccgagaccgcccacgtcgacgatatcgcggccaccatcgacctgctc
gaggcgttcctcgagaccgaggacggcgaccacgagtacacgttctag

DBGET integrated database retrieval system