KEGG   Natronococcus occultus: Natoc_0640Help
Entry
Natoc_0640        CDS       T02426                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nou  Natronococcus occultus
Pathway
nou00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nou01100  Metabolic pathways
nou01110  Biosynthesis of secondary metabolites
nou01130  Biosynthesis of antibiotics
nou01230  Biosynthesis of amino acids
Module
nou_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Natoc_0640
Enzymes [BR:nou01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Natoc_0640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh His_biosynth NanE QRPTase_C AP_endonuc_2 IMPDH Trp_syntA DHO_dh ThiG
Motif
Other DBs
NCBI-ProteinID: AGB36500
UniProt: L0JW18
Position
complement(621689..622462)
Genome map
AA seq 257 aa AA seqDB search
MTSQTELDSAVREILAAARERSTDGRERVSVDARSLPDALARAEREGRVPIVAEVKPTSP
TAEGTRADDPVELAEAMVAGGAAAISVLTEPDHFGGSPEALRRIRQAVDVPVLRKDFLLR
EAQLDAVEADLLLLIARFVDDLEKLVTAARERGFQPLVEVHDRDELEDALAAGAEIVGIN
NRDLARLEVDLGTFESVAPHVPDDVTVIAESGVSSPADVRRMRAAGADALLVGSAIMDHG
EESDVTENVRRLTETTQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacctctcaaacggagctcgactccgcggtccgggagatcctcgcggccgcgcgggag
cgctcgaccgacggccgggagcgggtgtcggtcgacgcgcgatcgctgcccgacgcgctg
gcccgggcggagcgcgagggccgcgtgccgatcgtcgcggaggtaaagccgacgagcccg
accgccgagggcacacgcgcggacgacccggtcgagctggccgaggcgatggtcgcgggc
ggcgcggcggcgatctcggtgctgaccgaacccgaccacttcgggggctcccccgaggcc
ctgcgacggatccgacaggccgtcgacgtccccgtgttgcggaaggacttcctgctccgc
gaggcccagctagacgctgtcgaggccgacctcctcctgctcatcgcgcggttcgtggac
gatctggagaagctggtaaccgccgcccgcgagcgagggttccagccgctcgtggaggtt
cacgatcgcgacgagctcgaggacgccctcgcggccggcgccgagatcgtcgggatcaac
aaccgggatctcgcgcgcctcgaggtcgatctcggaacgttcgagtccgtggcgccccac
gtgccagacgacgtgaccgtgatcgccgaaagcggcgtctcctcgccggcggacgtccgg
cggatgcgtgcggcgggcgccgacgccttgctcgtcggcagcgcgatcatggaccacggc
gaggagagcgacgtgaccgagaacgtgcgacgactgacggagacaacacaatga

DBGET integrated database retrieval system