KEGG   Natronococcus occultus: Natoc_0640Help
Entry
Natoc_0640        CDS       T02426                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nou  Natronococcus occultus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Natoc_0640
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Natoc_0640
Enzymes [BR:nou01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Natoc_0640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(621689..622462)
Genome map
AA seq 257 aa AA seqDB search
MTSQTELDSAVREILAAARERSTDGRERVSVDARSLPDALARAEREGRVPIVAEVKPTSP
TAEGTRADDPVELAEAMVAGGAAAISVLTEPDHFGGSPEALRRIRQAVDVPVLRKDFLLR
EAQLDAVEADLLLLIARFVDDLEKLVTAARERGFQPLVEVHDRDELEDALAAGAEIVGIN
NRDLARLEVDLGTFESVAPHVPDDVTVIAESGVSSPADVRRMRAAGADALLVGSAIMDHG
EESDVTENVRRLTETTQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacctctcaaacggagctcgactccgcggtccgggagatcctcgcggccgcgcgggag
cgctcgaccgacggccgggagcgggtgtcggtcgacgcgcgatcgctgcccgacgcgctg
gcccgggcggagcgcgagggccgcgtgccgatcgtcgcggaggtaaagccgacgagcccg
accgccgagggcacacgcgcggacgacccggtcgagctggccgaggcgatggtcgcgggc
ggcgcggcggcgatctcggtgctgaccgaacccgaccacttcgggggctcccccgaggcc
ctgcgacggatccgacaggccgtcgacgtccccgtgttgcggaaggacttcctgctccgc
gaggcccagctagacgctgtcgaggccgacctcctcctgctcatcgcgcggttcgtggac
gatctggagaagctggtaaccgccgcccgcgagcgagggttccagccgctcgtggaggtt
cacgatcgcgacgagctcgaggacgccctcgcggccggcgccgagatcgtcgggatcaac
aaccgggatctcgcgcgcctcgaggtcgatctcggaacgttcgagtccgtggcgccccac
gtgccagacgacgtgaccgtgatcgccgaaagcggcgtctcctcgccggcggacgtccgg
cggatgcgtgcggcgggcgccgacgccttgctcgtcggcagcgcgatcatggaccacggc
gaggagagcgacgtgaccgagaacgtgcgacgactgacggagacaacacaatga

DBGET integrated database retrieval system