KEGG   Natronococcus occultus: Natoc_0874Help
Entry
Natoc_0874        CDS       T02426                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nou  Natronococcus occultus
Pathway
nou00010  Glycolysis / Gluconeogenesis
nou00020  Citrate cycle (TCA cycle)
nou00620  Pyruvate metabolism
nou01100  Metabolic pathways
nou01110  Biosynthesis of secondary metabolites
nou01120  Microbial metabolism in diverse environments
nou01130  Biosynthesis of antibiotics
nou01200  Carbon metabolism
Module
nou_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Natoc_0874
   00020 Citrate cycle (TCA cycle)
    Natoc_0874
   00620 Pyruvate metabolism
    Natoc_0874
Enzymes [BR:nou01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Natoc_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding OsmC Biotin_lipoyl HlyD_3 IF-2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AGB36723
UniProt: L0JXZ0
Position
complement(843760..845565)
Genome map
AA seq 601 aa AA seqDB search
MGYVIKMPKLGLEMERGELLGWAVEEGETIEEGELVAEVESEKSIGEIDAREDGVLRRTY
LEPGESVPPGTPIGIVAPADADIGDLEAEVEAELEDVDAGETPAATADADSGAEAATDGA
TSEAATGAGAAADTGKVSPRARKRAEELGVELEGIEGTGYQGAVTEDDVERAAETNEGVA
TAVQASPRARKRAEELGVDLATVEGTGYQGSVTEDDVERAAESVDDAGRTLREERPFDGM
RRTIASRLGESYREAVHVTTHREADAEALFAAADAANDVLDADVSVQDVLLLAVSAALED
HPAFNATFEDDTHRLWADHNLGVAVDIEQGLIAPVLRNVEKKSLETVARERRELVGAALE
GEYTMDDLRGGTFTVTNLGVLGVESFDPVINPPQVAILGVDAVAERPTRDPDDGVEWRRH
LPFDLSFDHRVVDGADAARFLETLIERVEEPWSLLPEDVDRADGTETEMPGRTVTASNPE
GMAGRIEAGSFEWSYDEPEDAGGSETGPTPVDVFLGGLAACLSLSVRFQAEKRDAAVGEI
DVTTDAEPEHGAVEQLAATIRLESDADDDTLERIVDLGERGCHVSQLLREDLSLELSWER
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgggttatgttatcaagatgccgaagctcgggctggagatggaacgcggggagctgctg
gggtgggcggtcgaggaaggcgagacgatcgaagagggtgaactcgtcgccgaggtcgag
tccgagaagagcatcggtgagatcgacgcccgcgaggacggcgtcctccggcgaacctac
ctcgagccgggcgagtcggtgccgcccgggacgccgatcgggatcgtcgctcccgccgac
gcggatatcggcgaccttgaggccgaggtcgaggccgaactcgaggacgttgacgccggc
gagacgcctgctgcgaccgcggacgcggactcgggtgccgaagccgcgaccgacggtgcc
acctcggaggcggcgaccggggcgggggcggccgccgacacgggcaaggtctcgccacgc
gcacggaaacgggccgaggagctcggcgtggagctcgagggaatcgaggggacggggtac
cagggcgcggtcaccgaggacgacgtcgagcgtgcggccgagaccaacgagggcgtagcg
acggcggtccaggcctctccgcgggcccgcaagcgcgccgaggagttgggtgtcgacctc
gcgaccgtcgaagggacggggtaccagggatcggtcaccgaggacgacgtcgagcgtgcg
gccgaatcggtcgacgacgccggacgaacgctccgcgaggagcggcccttcgacgggatg
cgccgcacgatcgcctcgcggctcggcgagagctaccgcgaggccgtccacgtcacgacc
caccgcgaggccgacgccgaggcgctgttcgccgcggccgacgccgcgaacgacgtcctc
gacgccgacgtctccgtccaggacgtcctcctgctcgcggtctcggcggctctcgaggac
catcccgcgttcaacgcgaccttcgaggacgacacccaccgcctctgggcggaccacaac
ctcggggtcgccgtcgacatcgaacaggggctcatcgccccggtgctccggaacgtcgag
aagaagtccctcgagacggtcgcacgcgagcgccgcgagctcgtcggggccgccctcgag
ggcgagtacacgatggacgacctgcggggcgggacgttcacggtgacgaacctcggcgtg
ctgggcgtcgagtcgttcgatccggttatcaatccgccccaggtcgcgatcctcggagtc
gacgccgtcgccgaacgaccgacgcgggaccccgacgacggggtcgagtggcgccgtcac
ctcccgttcgacctctctttcgaccaccgggtcgtcgacggcgctgacgccgccaggttc
ctcgagacgctgatcgagcgcgtcgaggagccgtggtcgctgctccccgaggacgtcgac
cgcgcggacgggaccgaaaccgagatgcccggccgaaccgtcaccgcctctaatcccgaa
gggatggccggccggatcgaggcgggctcgttcgagtggtcctacgacgagcccgaggac
gccggcggctcggagaccggtcccaccccggtcgacgtcttcctcggcggactggcggcc
tgcctctcgctttcggttcggttccaggccgaaaagcgcgacgccgcagtcggcgagatc
gacgtcacgaccgacgccgaacccgagcacggcgccgtcgagcagctcgccgcgacgatt
cgcctcgagagcgacgccgacgacgacacgctcgagcggatcgtcgatctcggcgagcgg
ggctgtcacgtctcgcagctgcttcgcgaggacctgtcgctggagctctcctgggagcgt
ctctaa

DBGET integrated database retrieval system