KEGG   Natronococcus occultus: Natoc_1158Help
Entry
Natoc_1158        CDS       T02426                                 

Definition
succinate dehydrogenase, hydrophobic anchor subunit (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nou  Natronococcus occultus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Natoc_1158
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Natoc_1158
   00650 Butanoate metabolism
    Natoc_1158
  Energy metabolism
   00190 Oxidative phosphorylation
    Natoc_1158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1100803..1101168)
Genome map
AA seq 121 aa AA seqDB search
MAERYSSFTRGGTNWFLQRVTAAFLIVVLAFHFFQLHFVNHAADVTFMGTQARMENVGYF
LTMVLFLIAGTFHGVNGVYNALVNQGLEGTPKKVVLAVLVLAGIALIVQGIWVAVAMAGW
T
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacgctactcctctttcacgcggggcggtaccaactggttcctccagcgggtt
accgcggcgtttctgatcgtcgtgctggcgtttcacttcttccagctgcacttcgtgaac
cacgcggccgacgtcaccttcatgggtacgcaggcccgaatggagaacgttggatacttc
ctgacgatggtgttgttcctgatcgcggggacgttccacggcgtcaacggcgtctacaac
gccctggtcaaccagggactcgagggaacgcccaagaaggtcgtcctcgcggtcctcgtg
ctggccggaatcgcactcatcgtccagggtatctgggtcgcagtcgccatggcggggtgg
acctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system