KEGG   Natronococcus occultus: Natoc_1551Help
Entry
Natoc_1551        CDS       T02426                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
nou  Natronococcus occultus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nou00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:nou00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1509504..1510040
Genome map
AA seq 178 aa AA seqDB search
MTGTDPALETELELAGIVAVADNGVIGRDGEMPWHIPADLQHFKEATMDHPVIMGRVTYE
GILEALGEPLPGRTTVVLTSRALETPEDVVLARDLEDALETAERAAEERHDGGDTAFVAG
GATVYEQFLPVLDRLIVTEIHDAPDGDTEFPDWDRDDWTEVERDERDGFAFVEYVREE
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgacggggaccgaccctgcgctcgagaccgagctcgaactcgccgggatcgtcgccgtc
gccgacaacggcgtcatcgggcgggacggcgagatgccctggcacatcccggcggatctg
caacacttcaaggaggcgacgatggaccaccccgtgatcatgggacgggtgacctacgag
gggatcctcgaggcactgggcgagccgctgccggggcggacgacggtcgtcctcacgagc
cgggcgctcgagacgcccgaggacgtcgtcctcgcccgcgacctcgaagatgccctcgag
acggccgagcgcgcggccgaggagcgccacgacggcggcgacaccgccttcgtcgcgggt
ggggcgaccgtttacgaacagttcctgcccgttctcgatcggctgatcgtcaccgagatc
cacgacgctcccgacggcgacaccgagttccccgactgggaccgcgacgattggaccgag
gtcgagcgcgacgagcgtgacgggttcgcgttcgtcgagtacgtccgcgaggagtga

DBGET integrated database retrieval system