KEGG   Natronococcus occultus: Natoc_1574Help
Entry
Natoc_1574        CDS       T02426                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nou  Natronococcus occultus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Natoc_1574
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Natoc_1574
Enzymes [BR:nou01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Natoc_1574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1536493..1537431
Genome map
AA seq 312 aa AA seqDB search
MRHDHVITSKHLSRADIETVLDRAAEIAADPSAVADRHAGALLGLLFFEPSTRTKMSFET
AMKRLGGDVVDMGSVESSSVKKGETLADTVRVIEGYADALVLRHPKEGAATMASEFVDVP
LLNAGDGAGQHPTQTLLDLYTIRENAGLDDLTIGIMGDLKYGRTVHSLAYALSNFDTRQH
FISPESLQLPREVVYDLHQQQGGRAQLREHETLEDVLPELDVLYVTRIQRERFPDESEYR
KVAGEYQIDTETLEDAGDDLTVMHPLPRVDEIAPEIDDTDYAAYFEQAHNGVPVRMALLD
LLLSTDGGGGDE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcgccacgaccacgtgatcaccagcaaacacctctcgcgggccgacatcgagaccgtc
ctcgaccgggccgccgagatcgccgccgatccgtcggccgtcgcggatcgccacgccggg
gcgttgctcggactgctctttttcgagcccagcacgcgaacgaagatgagcttcgagacc
gcgatgaaacgcctgggtggcgacgtcgtcgacatgggctcggtcgagtcctcgagcgtc
aaaaagggcgagaccctcgccgacactgtccgggtcatcgaggggtacgccgacgcgctc
gttttgcgccaccccaaggagggtgcggcgacgatggcaagcgagttcgtcgacgtcccg
cttttgaacgccggcgacggggccggacagcacccgacccagaccctgctcgatctgtac
acgatccgcgagaacgccgggctcgacgacctgacgatcggaattatgggggacctgaag
tacggccggaccgtccactcgctggcctacgcgctctcgaacttcgacacccgtcaacac
ttcatcagcccggagagcctgcagctccctcgggaggtcgtctacgacctccaccagcaa
cagggcggtcgggcacagctccgcgaacacgagaccctcgaggacgtcctgcccgagctg
gacgtcctctacgtgacccggatccagcgcgagcggttccccgacgagtcggagtaccgg
aaggtcgcaggcgagtaccagatcgatacggagacgctcgaggacgcgggcgacgacctg
acggtaatgcacccgctcccgcgagtcgacgagatcgcacccgagatcgacgacaccgac
tacgccgcgtacttcgagcaggcccacaacggcgttccggtccggatggcgctgctcgat
ttgctcctgagcacggacggaggtggtggcgatgagtaa

DBGET integrated database retrieval system