KEGG   Natronococcus occultus: Natoc_2130Help
Entry
Natoc_2130        CDS       T02426                                 

Definition
transcriptional regulator/sugar kinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nou  Natronococcus occultus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Natoc_2130
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Natoc_2130
   00052 Galactose metabolism
    Natoc_2130
   00500 Starch and sucrose metabolism
    Natoc_2130
   00520 Amino sugar and nucleotide sugar metabolism
    Natoc_2130
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Natoc_2130
   00524 Butirosin and neomycin biosynthesis
    Natoc_2130
Enzymes [BR:nou01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Natoc_2130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2052984..2053961)
Genome map
AA seq 325 aa AA seqDB search
MVYYAGVDLGATNVRAAVADGEGATIGVSRNGTPRGPTGIDVTEGVLRTLREACGEAGVT
PGEIVAAGIGSIGPFDLAEGAVIDPANLPDSIDRIPLTGPVAELIDSDEVYLHNDTTAGV
IGERFHADRNPDDMVYITVSSGIGAGICCDGQILAGWDGNAGEVGHCVVDPRGRLTCGCG
HDGHWEAYCSGNAIPDYVRLLADDDPTIDTELPLESPDFTAKDVFELAGEDELADYAIEQ
LAHWNAIGVTNVVQSFAPIVVSFGGAVALHNEELVVDPIRERVSAMLLNNVPEIRVTDHG
DDVVLEGAVASALTRGTGDRERMRS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggtctactacgcgggcgtcgatctcggcgcgaccaacgtccgggcggccgtcgcggac
ggggagggagcgacgatcggcgtcagccgcaacgggacgccgcgaggtcccacgggaatc
gacgtcaccgagggagtgctccggacgcttcgcgaggcgtgtggtgaggcgggcgtcaca
ccgggcgagatcgtcgcggcggggatcggctcgatcgggccgttcgacctcgccgaaggg
gcggtgatcgacccggcgaaccttcccgactcgatcgatcgcattcccctcaccggtccc
gttgcagaacttatcgacagcgacgaggtctatctgcacaacgacacgaccgcgggcgtc
atcggcgagcggtttcacgccgaccgcaaccccgacgacatggtctacatcacggtctcg
tcggggatcggcgccggcatctgctgtgacggccagatcctcgccggctgggacggcaac
gcgggcgaggtcggtcactgcgtcgtcgacccccgcggccgactgacctgcggctgcggt
cacgacggccactgggaggcgtactgctcggggaacgcgatcccggactacgtccggctg
ctggccgacgacgatccgacgatcgataccgagcttcccctggagagccccgacttcacc
gcgaaggacgtcttcgagctggccggcgaggacgagctcgccgactacgcgatcgagcag
ctcgcccactggaacgccatcggcgtcacgaacgtcgtccagtcgtttgcgccgatcgtc
gtctccttcggcggggccgtcgccttacacaacgaggagctggtcgtcgatccgatccgc
gagcgggtctccgcgatgttgttgaacaacgtccccgagatccgggtcaccgaccacggc
gacgacgtcgtcctcgagggcgcggtcgcgagcgcgctcacgcgaggaaccggggaccgc
gagcggatgcgaagctga

DBGET integrated database retrieval system