KEGG   Natronococcus occultus: Natoc_2481Help
Entry
Natoc_2481        CDS       T02426                                 

Definition
coenzyme F420-0 gamma-glutamyl ligase (EC:6.3.2.31)
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
nou  Natronococcus occultus
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Natoc_2481
Enzymes [BR:nou01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Natoc_2481
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Natoc_2481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2383369..2384139
Genome map
AA seq 256 aa AA seqDB search
MELTAVTDLPEVRPGDDLAELVTDRAVLEPGDVLTVASTVVSKAEGRTADLEEFPVSGRA
KELAERIGAAAGEQKDPRFAQAVLEESTELLIECPFMLTETRFGHICVNAGIDRSNVPEH
DLLLLPRKPAESAERIRAGLADRGHEDVAVIVTDTCGRPFRHGQRGVALGWAGMSASRDW
RGEPDRDGRELGVTVQSVVDELASAANLVTGEGAGGTPAVVVSDWEFGELEGSDELFRDV
EDDLVRQALRNWRFDP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaactgacagcggtcacggatctgcccgaggtccgccccggcgacgacctcgccgaa
ctcgtcaccgatcgggccgtcctcgaaccgggcgacgtgctcaccgtcgcgagcacggtc
gtctcgaaggcagagggacggacggcggacctcgaggagttccccgtcagcggtcgtgcg
aaggagctcgccgagcgcatcggagcggccgcgggcgagcagaaagatccccggttcgcc
caggccgtcctcgaggagagcaccgaactcctgatcgagtgtccgttcatgctgaccgag
acgcggttcggacacatctgtgtcaacgcggggatcgatcgctcgaacgtcccggagcac
gatctcctcttgctcccgcgcaaaccggccgagagcgccgagcgcatccgggcgggactc
gcggaccgaggccacgaggacgtcgccgtgatcgtcaccgacacctgcgggcgaccgttc
cgtcacggccagcgcggcgtcgcgctcggctgggccgggatgtccgcgagccgcgactgg
cgcggcgagcccgaccgcgacggccgcgagctgggcgtcaccgtccagtcggtggtcgac
gagctggcaagcgccgcgaacctcgtcaccggcgagggtgcgggcggtacccccgcggtc
gtcgtcagcgactgggagttcggcgagctcgaggggagcgacgagctgtttcgggacgtc
gaggacgacctggttcgccaggccctgcggaactggaggttcgacccatga

  All links  
No link information was found.   
DBGET integrated database retrieval system