KEGG   Natronococcus occultus: Natoc_2673Help
Entry
Natoc_2673        CDS       T02426                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nou  Natronococcus occultus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Natoc_2673
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Natoc_2673
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Natoc_2673
Enzymes [BR:nou01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Natoc_2673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2569449..2570642
Genome map
AA seq 397 aa AA seqDB search
METTAAFTGLECVDCGATADADAESHRCPDCGGILDPSYDYDAVDLDHDVLGARPFDSLW
RYEELLPFSRESAVTMDEGATPLVECPTLADELGVGRLLIKDEGRNPTGTFKDRGQTVAV
TAADGHGASEVALASAGNAGQAAAAYAGRAGMESHVYVPSRSGFTNKAMINVHGGDMNVV
GGRIGEAVAAFEEGLAEHDDWYSLQTFATPYRHEGKKTMFYEIAEQLEWESPDVISYPTG
GGVGLVGMYKAAREFERLGLTDAVPSFYAAQASGCAPIVDAFEDGRDVHEPVEHPDTICG
GIEIPDPGASPWILEAIRESDGGAVATDDPEILEAAIAVAKREGLEMAPTCAAAVSGLFE
LADRGAFDGDETVVAVNTGTGNKEADVLRSHLMSKGV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggagacgacagccgccttcaccggcctcgagtgcgtcgactgcggcgcgaccgccgac
gccgacgcggagagccatcggtgtccggactgcggagggatcctcgatccgagctacgac
tacgacgccgtcgacctcgaccacgacgtcctcggcgcgcggccgttcgactcgctgtgg
cgctacgaggagctgctcccgttttcccgagagtcggccgtaacgatggacgagggggcg
acgccgctggtcgaatgtccgactctggccgacgagcttggggtcggccgactgctgatc
aaagacgagggacggaacccgacggggacgttcaaggaccgaggacagaccgttgccgtg
acggctgccgacgggcacggcgcgagcgaggtggcgctggcctcggcgggcaacgcgggc
caggccgccgcagcgtacgccggacgggcggggatggagtcccacgtttacgtcccttcc
cgatcgggctttacgaacaaggcgatgatcaacgtccacggcggcgacatgaacgtcgtc
ggcggacggatcggcgaggccgtcgcggccttcgaggaaggccttgcggagcacgacgac
tggtactctctccagacgttcgccacaccctaccgccacgaggggaagaagacgatgttc
tacgagatcgccgaacagctcgagtgggagagccccgacgtgatctcgtatcccacgggt
ggcggggtcggactcgtcggaatgtacaaggccgcccgcgagttcgagcgcctcggcctg
accgacgcggtgccgtccttttacgccgcccaggcgtcgggctgtgcgccgatcgtcgac
gccttcgaggacgggcgggacgtccacgagccggtcgaacacccggacacgatctgcggc
ggcatcgagatccccgaccccggcgcgagcccgtggatcctcgaggcgatccgcgagagc
gacgggggcgccgtcgcgaccgacgatcccgaaatcctcgaggccgctatcgcggtggcc
aagcgggagggcctcgagatggcgccgacctgtgccgcggcggtcagcggcctcttcgaa
ctcgccgatcggggcgccttcgacggcgacgagacggtcgtcgcggtcaacaccgggacg
gggaacaaggaggccgacgtccttcgcagccacctgatgagcaagggcgtctga

DBGET integrated database retrieval system