KEGG   Natronococcus occultus: Natoc_2697Help
Entry
Natoc_2697        CDS       T02426                                 

Definition
histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
nou  Natronococcus occultus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2594262..2595968)
Genome map
AA seq 568 aa AA seqDB search
MSTETPEPTETDAFEKVCETLVERILDGEIDRDEVEKAKLEACSEHSAPKVPKNSELLDH
APQEYREDLEAVLQRKPVRTASGVSPVAIMTSPERCPHGKCLYCPGGPDSEFSSSQSYTG
EEPAAARGVQNDYDPYGQVTLRLEQLREIGHPVDKVELILMGGTMTARSHDYQEWFVKRA
LEAMNDYDVDKEPEPAEGVSFAEDPEEYEFKYLEDVIAENETNEIRNIGTTFETKPDWCD
PEQIDRMLELGGTKVEVGVQTTYERINREMHRGHGAQASIDANRRLRNAGFKVGFHMMPG
QPGMSKEMCLEDFRRLFEQEQWKPDYLKIYPTLIVRGTATYDWWHKGEFDPLDNEEAAEL
VAEIKDMIPCYTRLQRVQRDIPADFIDAGVWKSNLRQLARKRMDEHGWSCDCIRCREAGH
HDEEPEDVELDVMSYDACGGTEQFISFEDFEKDLLVGFCRLRFPHGDGPADRTAAAAANG
DRLRPELENAALVRELHVYGSEVAMGDEGETGQHQHKGYGRRLMERAEELAADAGYDKIS
VISGIGAREYYRNKLGYHQDGPYVSKRL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgagacgcccgaaccgaccgaaaccgacgcgttcgagaaggtttgcgagacg
ctcgtcgagcggatcctcgacggcgagatcgaccgcgacgaggtcgaaaaggccaaactc
gaggcgtgttcggaacactcggcgccgaaggtgccgaaaaactccgagctgcttgatcac
gcgccccaggagtaccgcgaggatctggaggcggtgctccagcgcaaaccggtccggacc
gcctcgggcgtctccccggtcgcgatcatgacctcgcccgagcggtgtccccacgggaag
tgtctctactgtcccggcggccccgactcggagttctcgagctcccagagctacacgggc
gaggagcccgcggcggcgcggggcgtccagaacgactacgacccctacggccaggtgacc
ctgcggctcgaacagctccgggagatcggtcacccggtcgacaaggtcgagctgatcctg
atgggcgggacgatgaccgcccgcagtcacgactaccaggagtggttcgtcaaacgcgcc
ctggaggcgatgaacgactacgacgtcgacaaggagcccgaacctgccgagggcgtcagc
ttcgcggaggatcccgaggagtacgagttcaagtacctcgaggacgtcatcgcggaaaac
gagacgaacgagatcaggaacatcgggacgaccttcgagaccaagcccgactggtgtgac
cccgagcagatcgatcggatgctcgagctgggcgggacgaaagtcgaggtcggcgtccag
acgacctacgagcggatcaaccgcgagatgcaccgcggccacggcgcccaggcgtcgatc
gacgccaaccgccggctccggaacgcggggttcaaggtcggtttccacatgatgccgggc
cagccggggatgagcaaggagatgtgtctcgaggacttccgccggctgttcgagcaggaa
cagtggaagcccgactacctaaagatctacccgaccctgatcgttcgggggaccgcgacc
tacgactggtggcacaagggggagttcgacccgctcgacaacgaggaggccgcggagctg
gtcgccgagatcaaagacatgattccctgctacacgcgcctccagcgggtccagcgagac
atccccgcggacttcatcgacgccggcgtctggaagtcgaacctgcgacagctcgcccgg
aagcggatggacgagcacggctggtcctgtgactgtatccgctgtcgggaggccggccac
cacgacgaggagcccgaggacgtcgagctcgacgtaatgagctacgacgcctgcggcggg
acggagcagttcatctcgttcgaggacttcgagaaggatctcctggtcgggttctgtcga
ctccgattccctcacggcgacggacccgcggaccgcaccgcggcagccgccgcgaacggc
gatcgactccggccggagctcgagaacgccgccctcgtccgcgaactgcacgtttacgga
agcgaggtcgccatgggcgacgagggcgaaaccggacagcaccagcacaaggggtacggc
cgccggctgatggagcgcgccgaggaactcgcggccgacgccggctacgacaagatcagc
gtcatctccgggatcggcgcgcgggagtactaccggaacaagctgggctaccaccaggac
ggcccctacgtgagcaagcgactctga

DBGET integrated database retrieval system