KEGG   Natronococcus occultus: Natoc_3439Help
Entry
Natoc_3439        CDS       T02426                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
nou  Natronococcus occultus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Natoc_3439
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Natoc_3439
Enzymes [BR:nou01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Natoc_3439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3373702..3374622
Genome map
AA seq 306 aa AA seqDB search
MSSTVRIIGAPMDYGANRRGVDMGPSAIRYAGLADELEGTGVEPVDAGDLLIPRAEERDP
DATQPREGNAKFLREVGDVCSRLSEEVAETLADGAFPLVLGGDHSVAIGSMAGASRTATL
GAIWFDAHADLNTPESSPSGNVHGMPLAAALGRGAFAEMEWANAPNLREDAIAYVGLRSI
DDREREWVRDSEMTAFTMADIDERGITAVVEDALDVATTGTDGIHVSLDLDWLDPNAAPG
VGTPVRGGVTYREAHSALERVSVRNADEGVLRSMDVVEVNPILDERNETATLAADLTASA
FGKRIL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcactgttcgaatcatcggtgcaccgatggactacggggcgaaccgccgcggc
gtggacatgggtccatcggcgatcaggtacgccggactggccgacgaactcgaggggacc
ggcgtcgagccggtcgacgccggcgacctccttattcctcgcgccgaggaacgcgatccc
gacgccacgcagccacgcgagggcaacgccaagttcctccgcgaggtcggtgacgtctgc
tcgcgactctccgaggaggtcgcggagacgcttgccgacggggcctttccactggtcctc
ggtggcgatcactcggtcgcgatcgggtcgatggcgggtgcctcgcggacggcaacgctc
ggagcgatctggttcgacgcccacgcggatctcaacacgcccgagtcctcgccgagcggg
aacgtccacgggatgcccctcgccgcggcgctgggtcggggcgcgttcgccgagatggag
tgggccaacgcaccgaatctccgcgaggacgcgatcgcctacgtcggactacgaagcatc
gacgaccgcgaacgcgagtgggtgcgcgacagcgagatgaccgcgttcacgatggccgat
atcgacgaacggggcatcaccgccgtcgtcgaggacgccctcgacgtcgcgacgaccggc
accgacgggatccacgtcagcctggatctggactggctcgacccgaacgccgcacccggc
gtcggaacgccggttcggggcggggtcacctatcgggaggcccactcggcgctcgagcgg
gtctcggtccgcaacgccgacgagggcgtccttcgatcgatggacgtcgtcgaggtgaac
ccgattctcgacgagcgaaacgagacggcaacgcttgcggccgatcttacggccagcgcg
ttcggcaagcggatactctga

DBGET integrated database retrieval system