KEGG   Natronococcus occultus: Natoc_3781Help
Entry
Natoc_3781        CDS       T02426                                 

Definition
theronine dehydrogenase-like Zn-dependent dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
nou  Natronococcus occultus
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nou01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:nou00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:nou00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3711752..3712918)
Genome map
AA seq 388 aa AA seqDB search
MSMDAVVYQGPHEVAVEEVDEPEIEHPNDVVVDITTTAICGSDLHMYEGRTAAEEGIVFG
HENMGVVSEVGEAVTSLEEGDRVVMPFNVACGFCQNCEEGYTGFCTNVNPGFAGGAYGYV
AMGPYKGGQAEKLRVPYADFNALKLPEGDAHEDAFALLADIFPTGWHGTRLADLKPGESI
AIYGAGPVGLMAAYSAKLQGAAEIYVVDRVPSRLEMAEDHCDAHAINFEEGDPVEQIVEA
HGDEVDKGVDAVGYQAIDPETDPGDDAYDPARENPAVVLNQLIQTVRPTGAIGVPGLYVP
SDPGAPDEMAAQGRLGIDFGKLFEKGHRFGTGQCNVKEYNRQLRDMIIEGRADPSWVVSH
RVDLEEAPEMYERFDDREEGVVKVLLEP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatggacgctgtcgtataccaggggccacacgaggtcgccgtcgaagaggtagac
gagccggagatcgaacacccgaacgacgtcgtcgtcgacatcacgacgaccgcaatctgt
gggtcagacctccacatgtacgagggccgaaccgccgccgaggaggggatcgtcttcggc
cacgagaacatgggggtcgtcagcgaggtcggcgaggcggtcacgagccttgaggaggga
gaccgagtcgtcatgccgttcaacgttgcctgcgggttctgtcagaactgcgaggagggg
tatacggggttctgtacgaacgtcaaccccgggttcgcgggcggcgcctacggctacgtg
gcgatgggtccatacaagggtggacaggccgagaaactccgcgttccctacgccgacttc
aacgcactgaaactccccgagggcgacgcacacgaggacgccttcgcactgctggccgac
atcttcccgacagggtggcacggcacccggctcgcggatctcaaaccgggtgagtcgatc
gcgatctacggggcggggccggtggggctgatggccgcctacagcgcgaagctacagggt
gccgccgaaatctacgtcgtcgatcgggttccgagccgcctcgagatggccgaggaccac
tgcgacgcccacgcgatcaacttcgaggagggtgacccggtcgaacagatcgtcgaggcc
cacggcgacgaggtcgacaagggcgtcgacgccgtcggctaccaggcgatcgaccccgag
acggatccgggcgacgacgcctacgatccggctcgcgagaaccccgcggtcgtgctcaac
cagctgatccagacggtccggccgaccggcgcgatcggcgtcccggggctgtacgtccca
tccgaccccggcgcgccggacgagatggccgctcagggccggctcgggatcgacttcggg
aagctcttcgagaaaggccaccggttcggcaccggccagtgtaacgtcaaggagtacaac
cgccagctccgggatatgatcatcgaggggcgggccgaccccagctgggtcgtctcccac
cgggtcgacctcgaggaggcccccgagatgtacgagcgcttcgacgaccgcgaagagggc
gtcgtcaaggtcctgctcgagccctga

DBGET integrated database retrieval system