KEGG   Natronococcus occultus: Natoc_3844Help
Entry
Natoc_3844        CDS       T02426                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nou  Natronococcus occultus
Pathway
nou00010  Glycolysis / Gluconeogenesis
nou00020  Citrate cycle (TCA cycle)
nou00620  Pyruvate metabolism
nou01100  Metabolic pathways
nou01110  Biosynthesis of secondary metabolites
nou01120  Microbial metabolism in diverse environments
nou01130  Biosynthesis of antibiotics
nou01200  Carbon metabolism
Module
nou_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Natoc_3844
   00020 Citrate cycle (TCA cycle)
    Natoc_3844
   00620 Pyruvate metabolism
    Natoc_3844
Enzymes [BR:nou01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Natoc_3844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl GCV_H Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AGB39545
UniProt: L0K4R3
Position
complement(3775181..3776803)
Genome map
AA seq 540 aa AA seqDB search
MVREFKLPDVGEGVAEGELVSWLVEPGDEVSEDQPVAEVETDKALVEVPSPVNGTVRELH
WEEGEMVPVGDLFVTYDVEGEERTDESTTSEEERASEPPGVDSPEGTQTDADGEPAGDAG
ATGAETGEVEPPEDRVFAPPRVRRLAREEGIDLSTLEGSGPGGRITAADVEAAAGGSDTS
SESVEAETTPEGTTSETGAESAVASDAGSPSGSQTTQSTTPDQVESADRDRTLAAPATRK
LAEEEGVDIDAVPTDEERDGEPYVTPEAVREYAEAQQRAQEADAEAVSAGEPVGAKGTAF
PEGERERREPFKGVRKTIADAMVESKYSAPHVTHHDEVDVTELVEARDRLKPRAEEQGIS
LTYMPFIMTAVTAALKEFPEMNAVIDEDNEEIVYRDYYNVGIATATDVGLMVPVLEDADR
KGLLQLSSEMNELVTKARERSISPDELRGSTFTITNVGGIGGEYATPILNYPESGILAVG
EIKRKPRVVTDDDGEESIEPRSVMTLSLSFDHRLIDGAVGARFTNKVMEYLENPELLLLE
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggtacgagagttcaagctgcccgacgtcggcgaaggcgtcgccgagggtgaactggtg
agctggctggtcgaaccgggcgacgaggttagcgaggaccagccagtcgcggaggtcgag
accgacaaggccctcgtcgaggttccgtccccggtcaacggcaccgttagagaactccac
tgggaggaaggcgagatggtccccgtcggcgacctgttcgttacgtacgacgtggagggc
gaggagcgcacggacgaatcgaccacctcggaagaagaacgagccagcgaacccccgggt
gtcgactcgcccgaggggacccagacagacgccgacggcgaacctgccggcgacgctggc
gcgacgggtgccgaaaccggtgaggtcgaacccccagaagaccgggtcttcgcaccgccg
cgggtacgacggttggcccgcgaggaggggatcgatctctcgacgctcgagggcagcggt
cccggcggtcgaatcaccgcagccgacgtggaagccgccgcgggcggatcggacacgtcc
tcggagtcggtggaagccgagacgacacccgaagggaccacctcggagacgggtgccgag
agcgccgtcgcgagcgacgcgggttccccttccgggagccagacgacccagtcgacgaca
ccggatcaggtcgagtcggccgaccgcgatcggactctggctgcgcccgcaactcgaaag
ctcgccgaggaggagggtgtcgacatcgacgccgtcccgaccgacgaggaacgcgacggc
gagccctacgtcacccccgaggccgtccgggagtacgccgaggcccagcaacgagcccag
gaggccgacgcagaggcagtctcggcgggtgaacccgtcggcgcgaaggggacggcgttc
cccgagggcgaacgcgaacgtcgggaacccttcaaaggcgttcgcaagaccatcgccgac
gcgatggtcgagtcgaagtactccgcgccccacgtcacccaccacgacgaggtcgacgtt
accgaactcgtcgaggcgcgcgatcggctcaagccccgcgccgaggaacaggggatcagc
ctcacctacatgccgtttatcatgacggccgtgacggctgcactgaaggagttccccgaa
atgaacgcggtgatcgacgaggacaacgaggagatcgtctaccgggactactacaacgtc
ggcatcgccacggcaaccgacgtcggcctgatggtacccgtcctcgaggacgccgaccgg
aaggggctcctgcagctgtcctcggagatgaacgagctcgtcacgaaggcccgagaacgc
tcgatcagtcccgacgagcttcggggttcgacgtttacgatcacgaacgtcggggggatc
ggcggcgagtacgcgaccccgatcctgaactatccggagtcgggcatcctcgcggtcggc
gagatcaaacgcaagccgcgggtcgtcacggacgacgacggcgaggagtcgatcgagccg
cgctcggtgatgacgctgtcgctgtcgttcgatcaccggttgatcgacggtgcggttggt
gcacggtttacgaacaaagtgatggagtacctcgagaatccggaactgctactgctcgaa
tga

DBGET integrated database retrieval system