KEGG   Natronococcus occultus: Natoc_3931Help
Entry
Natoc_3931        CDS       T02426                                 

Definition
(GenBank) phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nou  Natronococcus occultus
Pathway
nou00010  Glycolysis / Gluconeogenesis
nou00030  Pentose phosphate pathway
nou00051  Fructose and mannose metabolism
nou00052  Galactose metabolism
nou00230  Purine metabolism
nou00500  Starch and sucrose metabolism
nou00520  Amino sugar and nucleotide sugar metabolism
nou00521  Streptomycin biosynthesis
nou01100  Metabolic pathways
nou01110  Biosynthesis of secondary metabolites
nou01120  Microbial metabolism in diverse environments
nou01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Natoc_3931
   00030 Pentose phosphate pathway
    Natoc_3931
   00051 Fructose and mannose metabolism
    Natoc_3931
   00052 Galactose metabolism
    Natoc_3931
   00500 Starch and sucrose metabolism
    Natoc_3931
   00520 Amino sugar and nucleotide sugar metabolism
    Natoc_3931
  Nucleotide metabolism
   00230 Purine metabolism
    Natoc_3931
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Natoc_3931
Enzymes [BR:nou01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Natoc_3931
    5.4.2.8  phosphomannomutase
     Natoc_3931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AGB39629
UniProt: L0K5G7
Position
3874028..3875392
Genome map
AA seq 454 aa AA seqDB search
MQVFGSSGTRGVANEELTPAFVLRVAKAAGTAWGVGRIAIARDTRHTGQMLADAAASGLA
STGTDVDRLGITPTPGAQAYAEREDVPVMVITASHNPPQYNGVKLVDSDGVELAVADLEK
IEETLLAEAFTVAPWDETGRVRDVEGARREYIEELLEAVNRERIADADLTIALDPGHGAG
SLTSPELFRRLGCRVVTVNGQPDGHFPGRDPEPVRSNLGDLGRLVRSTDADIGIAHDGDA
DRAIFFDEDGEYVEGDATLAALAAAELEPDDTTVSAVNVSQRLVDVVNEIGAELELTPIG
STNIITRIRELEAKNKHVPVAGEGNGGIFFPNYRLTRDGAYTAARFLELVADDPVSEIVA
PYSGYANVRRNIEYESTAERDAMLDAAANHAQEADAELNTRDGYRLDHGDAWVLARPSGT
EPLVRIYAEARDGDRANGLADEMYETLAEAKTDA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtattcggatctagcgggacgcggggcgtcgccaacgaggagctgacgcccgcg
ttcgttctgcgcgtcgcgaaggcagcggggacggcctggggggtcggccgtatcgcgatc
gcacgcgacacccgccacaccggacagatgctcgccgacgccgccgccagcggcctggcg
agtacggggaccgacgtcgaccggctcggaatcacgcccacgcccggtgcccaggcctac
gccgagcgcgaggacgttccggtcatggtcatcacggcctcgcacaacccgccccagtac
aacggcgtcaagctcgtcgatagcgacggggtcgagctcgccgtcgccgacctcgagaag
atcgaggagacgctgcttgcggaggccttcacagtcgccccctgggacgagaccgggcgc
gttcgggacgtcgagggagccagacgagagtacatcgaggagctgctcgaggccgtcaat
cgcgagcggatcgcagacgccgacctgacgatcgcgctcgacccgggtcacggcgcgggc
tcgttgaccagtccggagctcttccgccggctgggctgtcgggtcgtcaccgtcaacggg
cagcccgacggccacttccctggtcgcgaccccgagccggtgcgctcgaacctgggcgat
ctgggccgactcgtccgttcgaccgacgccgacatcgggatcgcccacgacggcgacgcc
gaccgcgcgatcttcttcgacgaggacggcgagtacgtcgagggcgacgcgacgctggcg
gcgctcgcggcggccgagctcgagcccgacgacaccaccgtctcggcggtcaacgtctcc
cagcggctggtcgacgtcgtcaacgagatcggcgccgagctcgagctgacgccgatcggc
tcgacgaacatcatcacccggatccgggagctcgaggccaagaacaaacacgtccccgtc
gcgggcgagggcaacggcgggatcttcttcccgaactaccggctcacccgcgacggcgcc
tacacggccgcgcggttcctcgagctcgtcgccgacgacccagtcagcgagattgtcgcc
ccctacagcggctacgcgaacgttcggcgcaacatcgagtacgagtcgacggccgagcgc
gacgcgatgctcgacgccgcggccaaccacgcccaggaggccgacgccgagctcaacacc
cgcgacggctaccggctcgatcacggggacgcgtgggtgctggcccggccgtccggcacc
gagccgctcgtccggatctacgccgaggcccgcgacggcgaccgggcgaacgggctcgcc
gacgagatgtacgagaccctggccgaagcgaagaccgacgcctga

DBGET integrated database retrieval system