KEGG   Natronococcus occultus: Natoc_3989Help
Entry
Natoc_3989        CDS       T02426                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nou  Natronococcus occultus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Natoc_3989
Enzymes [BR:nou01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Natoc_3989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3932407..3933150
Genome map
AA seq 247 aa AA seqDB search
MRDLSVAVFRPDDERLADAVELLDSLGATPVPDPMLSVEATGATPREDADYAVLTSKTGA
ELVAGSGWEPGSATVCAIGPKTADAVRRVGYDVDVVPEEYTSSGLVETLADELDGARVEV
ARSDHGSPVLLSGFEDAGAYVHETILYRLVRPAGSGESAERAAAGELDAACFTSSLTVEH
FLEAAADRGLREEAIAGLEAATVGVIGEPTRETAAELGLDVDLVASEATFDALACETVEA
AAPTYHD
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcgagacctttccgtcgccgtgtttcggcccgacgacgaacggctcgccgacgccgtc
gaactgctcgactcgctgggtgcaaccccggtaccggatccgatgctgtcggtcgaagcg
acgggtgcaacgccccgcgaggacgccgactacgccgtcctgacgagcaagacgggcgct
gagctggtcgccggctccggctgggagcccggttcggcgaccgtctgtgcgatcggcccg
aagaccgccgacgccgttcgacgggtcggctacgacgtcgacgtcgtccccgaggagtac
acctcgagcggactggtcgagaccctcgccgacgagctcgacggggcacgcgtcgaggtc
gcccgcagcgaccacggcagccccgttttgctttcggggttcgaggacgccggggcgtac
gtccacgagacgatcctctaccggctcgtccgccccgcggggagcggcgagtcggccgag
cgggccgccgccggcgagctcgacgcggcttgctttacgtcctcgttgaccgtcgagcac
ttcctcgaggcggccgccgaccgcggcctgcgcgaggaggcgatcgcaggactggaagcg
gcaaccgtcggcgtcatcggtgagccgacccgcgaaaccgccgctgagctggggctcgac
gtcgatctggtcgcgagcgaggcgaccttcgacgcgctggcctgcgagaccgtcgaggcg
gccgccccgacctaccacgactga

DBGET integrated database retrieval system