KEGG   Natronococcus occultus: Natoc_4267Help
Entry
Natoc_4267        CDS       T02426                                 

Definition
Mg-chelatase subunit ChlI (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
nou  Natronococcus occultus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Natoc_4267
Enzymes [BR:nou01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Natoc_4267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p2:184852..187044
Genome map
AA seq 730 aa AA seqDB search
MVANAGGKKLSSLPFPAIVGQSELKRALLTVAANDALDGALVVGEKGTAKSTTVRGLVDL
LPEQRAIADCRYGCAPDDPTLQCADCRERDPDERPVETRPVPLVTLPLGATRDRVVGTLS
VEDALAGEAEFDPGLLARAHRGILYVDEVNLLDDHLVDVVLDAAASGINTVERDGVSVSH
PASFTLIGTMNPEEGELRPQLRDRFALRATVEGCRDVSDRVEIIDRALGRGADPNPADTA
EAVDRLGETVAGARERLSRVELPDEFKAEIAELCLEAGVDGHRGDIATARVARTLAALEG
RTTVIESDVREAITYALPHRLRSTPFEDEPELDDLLEDRFDEGADETDGGDGADGNDNDG
DGETESEDGRDCESDADADDGRGRDEPGEADGGSDRSDSTNDDERDGTERGRRPSEDDRS
ASAEAERASAGDRDGSAGATGDRSESDEDGSNGESNEDGGAARPLVPGRRAEIGKGSAPT
LETPEAAGDRRARAEGSRATVAPDAENRGARVRTEAASDDGPIDAAASVRSAATRGASDV
EAEDLRRSVRAGEASTTIVFAVDASASMRPAMRTAKGVVLDLLRDSYQQRDDVAFVAFAG
EDADVLLPPTDSVALAARHLKELPSGDRTPLPAGLETARAVVERADSETAIVVLVTDGRA
TVADGSPTDATRDAARRLAETGTAVVVVDAGDDSRAGLSALVADEADGERVPLSSLSAEL
VRSAVDSAGE
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaaacgccgggggtaaaaaactgtcgtcgctcccgtttccggcgatcgtcggc
cagtcggagctcaagcgcgcgctgctgacggtcgccgcgaacgacgcgctcgacggcgcg
ttggtcgtcggagagaaggggacggcgaagtcgaccaccgtccgaggactcgtcgatctc
ctcccagaacagcgcgccatcgcggactgtcggtacggctgtgcgcccgacgacccgacg
ctgcagtgcgcggactgtcgggagcgcgatcccgacgagcgacccgtcgagacgcggccc
gtgccgctggtcacgctcccgctcggggcgacccgcgaccgggtcgtcgggacgctctcg
gtcgaggacgccctcgccggcgaggccgagttcgatcccggactgttggcccgcgcgcac
cgggggatcctctacgtcgacgaggtcaacctgctcgacgatcacctcgtcgacgtcgtt
ctggacgcggcagcgagcgggatcaacaccgtcgagcgcgacggcgtcagcgtctcccat
cccgcgtcgttcacgctgatcggaacgatgaatcccgaagagggcgagcttcggccacag
ctccgggatcggttcgccctccgggcgaccgtcgaggggtgccgggacgtctcggatcgc
gtcgagatcatcgaccgggcactcggacgcggcgccgacccgaacccggccgacacggcc
gaagccgtcgatcggctcggcgagaccgtagccggggcgcgcgaacggctctcccgcgtc
gagcttcccgacgagttcaaagccgagatcgccgagctctgcctcgaggccggcgtcgac
ggccaccgcggcgacatcgcgacggccagggtcgcgaggacgctggccgcgctcgagggc
cgaacgacggtgatcgagtcggacgttcgcgaggcgatcacctacgcgctcccgcaccgc
ctccggagcacgccgttcgaggacgagccggagctcgacgacctgctggaggaccggttc
gacgagggggcagacgagacggacgggggcgacggggccgacgggaacgacaacgacgga
gacggggagaccgaatccgaggacggccgcgactgcgaatccgatgctgacgccgacgac
ggccgcggccgcgacgagcccggcgaggccgacggcggctcggatcggtcggacagcacg
aacgacgacgagcgcgacggaacggagcgcggacggcgaccgagcgaggacgaccggtcg
gcgtcggccgaggcggagcgagcgagcgcgggcgatcgcgacggatcggcgggcgcgacc
ggggatcgctcggaatcagacgaggacggttccaacggggagtcgaacgaagatggtggc
gccgctcgaccgctcgttcccggccgtcgggccgagatcggcaagggaagcgcaccgacg
ctcgagacgcccgaagccgcgggcgaccgccgtgcccgtgcggaagggagccgagcgacc
gtcgcgccggacgccgagaaccgcggcgcccgcgtcaggacggaagccgcgtcggacgac
ggcccgatcgacgcggcggcgtcggtccggtcggccgcgacccgcggcgcgtccgacgtc
gaggcggaggaccttcgccggtccgttcgcgccggggaggcgtcgacgacgatcgtcttc
gccgtcgacgcgagcgcgtcgatgcggcccgcgatgcgaaccgcgaagggcgtcgtcctc
gacctgttgcgggacagctaccagcaacgcgacgacgtcgcgttcgtcgcgttcgcgggc
gaggacgccgacgtgttgctcccgccgaccgacagcgttgccctcgcggcgcgccacctc
aaggagctgccgtctggcgaccggacgccgctgcccgccggcctcgagaccgcccgggcg
gtcgtcgagcgcgcggattccgagacggccatcgtcgtcctcgttaccgacggcagggca
accgtcgccgacggaagcccaacggacgccacgcgcgacgcggcccggaggctcgcggag
accggaacggcggtcgtcgtcgttgacgccggcgacgactcccgcgccgggctctcggcg
ctcgtcgccgacgaggccgacggcgagcgcgtcccgctgtcgtcgctctcggcggagctg
gttcgctcggccgtcgattcggcgggtgagtag

DBGET integrated database retrieval system