KEGG   Neofusicoccum parvum: UCRNP2_3909Help
Entry
UCRNP2_3909       CDS       T03126                                 

Definition
(RefSeq) putative nadh-cytochrome b5 reductase protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
npa  Neofusicoccum parvum
Pathway
npa00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:npa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    UCRNP2_3909
Enzymes [BR:npa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     UCRNP2_3909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 19023149
NCBI-ProteinID: XP_007583198
UniProt: R1GTB8
Position
Unknown
AA seq 305 aa AA seqDB search
MSDALAPQYVHGVYIPSALLIVGTAIVKKEWVPFALVIAALLGGWKVYSNQARKVLKPDV
FQEFELTEKTVLSHNTAIYRFALPRPTDILGLPIGQHISIAATIEGQPKEVVRSYTPISS
DEDRGHVDLLIKSYPTGNISKYVAGLSVGQSIKVRGPKGAMVYTPNMVRHFGMIAGGTGI
TPMLQIIKAINRGRAHGDRTEVDLLFANVNPEDILLREDLDALAAKDPGFRVHYVLNNPP
EGWTGGVGFVTADMIKAKLPAAAKDVKVLICGPPPMVSAMKKAAESLGYDKARPVSKLDD
QVFCF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgcgctcgcgccgcagtacgtgcacggcgtgtacatcccgtcggctctcttg
atcgtgggcaccgccattgtcaagaaggaatgggtgcctttcgcgctggtcatcgccgcg
ctcctgggcggctggaaggtctacagcaaccaggcccgcaaggtgctcaagcccgacgtg
ttccaggagtttgagctcacggagaagaccgtcctctcgcacaacaccgccatctaccgc
ttcgccctcccccgcccgaccgacatcctcggcctccccatcggccagcacatctccatc
gccgcgacgatcgaagggcagccgaaggaagtggtgcgctcgtacacgcccatctcgtcc
gacgaggaccgcggccacgtcgacctgctgatcaagtcgtacccgacgggcaacatctcc
aagtacgtggccgggctcagcgtcgggcagtcgatcaaggtccgcggccccaagggcgcc
atggtctacacgcccaacatggtgcgccactttggcatgatcgcgggcggcaccggcatc
acccccatgctgcagatcatcaaggccatcaaccgcggccgcgcccacggcgaccgcacc
gaggtcgacctcctcttcgcaaacgtcaaccccgaggacatcctgctgcgcgaggatctc
gacgccctggccgcaaaggaccccggcttccgcgtgcactacgtcctgaataacccgccg
gagggctggaccggcggtgtcggcttcgtgactgccgatatgatcaaggccaagctcccg
gctgccgcaaaggacgtcaaggtcctcatctgcggtcctcctcccatggtcagcgccatg
aagaaggccgccgagtccctgggctacgataaggccaggccagtcagcaagctcgacgac
caggttttctgcttctaa

DBGET integrated database retrieval system