KEGG   Natrinema pellirubrum: Natpe_0082Help
Entry
Natpe_0082        CDS       T02425                                 

Definition
phosphoglucosamine mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
npe  Natrinema pellirubrum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Natpe_0082
   00030 Pentose phosphate pathway
    Natpe_0082
   00051 Fructose and mannose metabolism
    Natpe_0082
   00052 Galactose metabolism
    Natpe_0082
   00500 Starch and sucrose metabolism
    Natpe_0082
   00520 Amino sugar and nucleotide sugar metabolism
    Natpe_0082
  Nucleotide metabolism
   00230 Purine metabolism
    Natpe_0082
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Natpe_0082
Enzymes [BR:npe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Natpe_0082
    5.4.2.8  phosphomannomutase
     Natpe_0082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
73727..75103
Genome map
AA seq 458 aa AA seqDB search
MEIFGSSGTRGVANEELTPAFVLRVAKAAGTIWAEDAGAERVGIARDTRYTGRMLADAAA
SGLASIGIDVDRLGIVPTPGAQTYAEHEAVPVIVVTASHNPPQYNGIKLVGADGVELSVA
TLETIEDRLLTESFTAAAWDETGRVREIDGVRRAYVEGLLAAVDRQPIADADLTVALDPG
HGAGALTSPEFFRELGCRVVTVNGQPDGHFPGRDPEPVPDNLADLGRLVRSTDADVGIAH
DGDADRAIFFDEDGEYVEGDATLAALAAAELEAGDTTVSAVNVSQRLVDVVNEVGADLEL
TPIGSTNIITRIRELEASGQRVPIAGEGNGGIFFPNYRLSRDGAFTAARFLELVAERPVS
EIVAPYDGYVNVRRNLEYESTAERDAMLDAAANQAKAADAELNTRDGYRLDYGDAWVLAR
PSGTEPLVRIYAEARDGDRAEELVDDMYEALADAKADA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggagatattcggatcgagcgggacgcggggcgtcgccaacgaggagttgacgcccgcg
ttcgtcctccgcgttgcgaaggcggcggggacgatctgggccgaggacgccggcgcggag
cgggtcgggatcgctcgcgacacccgctacaccggccgcatgctggccgatgcggccgcc
agtgggttagcgagcatcggcatcgacgtcgaccgactggggatcgttcctacccctggc
gcacagacctacgccgaacacgaggcggtcccagtgatcgtcgtcacggcctcgcacaac
ccaccccagtacaacgggatcaaactcgtcggggccgacggcgtcgaactctcggtcgcg
accctcgagaccatcgaggaccgactgctgaccgagtcgttcaccgcggccgcctgggac
gagacgggccgggtccgcgagatcgacggcgttcgccgggcctacgtcgaggggttgctc
gcggccgtcgaccgccagccgatcgccgacgcggacctgaccgtcgcgttggatcccggc
cacggcgcgggcgcgctgaccagccccgagttcttccgggaactgggctgtcgggtcgtt
accgtcaacggccagccggacggccacttccccggtcgtgaccccgaaccggtccccgac
aacctcgccgatctgggtcggctcgtccgatcgaccgacgccgacgtcgggatcgcccac
gacggcgacgccgaccgcgcgattttcttcgacgaggacggcgagtacgtcgagggcgac
gccacgctcgcggcgcttgcggccgccgaactcgaggccggcgacacgaccgtctcggcg
gtcaacgtctcccagcggctcgtcgacgtcgtgaacgaggtcggggccgacctcgaactc
accccgatcggttcgacgaacatcatcacccgcatccgcgaactcgaggcctcgggccag
cgggtcccgatcgccggcgagggcaacggcgggatcttcttcccgaactaccggctctcc
cgggacggggccttcaccgcggcccgattcctcgaactcgtggccgagcggccggtcagc
gagatcgtcgccccctacgacggctacgtcaacgtccggcgcaacctcgagtacgagtcg
acggcggaacgcgacgcgatgctcgatgcggccgccaatcaggccaaagcggccgacgcg
gaactcaacactcgagacggctaccggctggattacggcgatgcgtgggtgctggcccgc
ccctccggcaccgagccgctcgtccggatctacgccgaggcccgcgacggcgaccgtgcc
gaggaactcgtcgacgacatgtacgaggcgctggccgacgcgaaggccgacgcctga

DBGET integrated database retrieval system