KEGG   Natrinema pellirubrum: Natpe_0082Help
Entry
Natpe_0082        CDS       T02425                                 

Definition
(GenBank) phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
npe  Natrinema pellirubrum
Pathway
npe00010  Glycolysis / Gluconeogenesis
npe00030  Pentose phosphate pathway
npe00051  Fructose and mannose metabolism
npe00052  Galactose metabolism
npe00230  Purine metabolism
npe00500  Starch and sucrose metabolism
npe00520  Amino sugar and nucleotide sugar metabolism
npe00521  Streptomycin biosynthesis
npe01100  Metabolic pathways
npe01110  Biosynthesis of secondary metabolites
npe01120  Microbial metabolism in diverse environments
npe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Natpe_0082
   00030 Pentose phosphate pathway
    Natpe_0082
   00051 Fructose and mannose metabolism
    Natpe_0082
   00052 Galactose metabolism
    Natpe_0082
   00500 Starch and sucrose metabolism
    Natpe_0082
   00520 Amino sugar and nucleotide sugar metabolism
    Natpe_0082
  Nucleotide metabolism
   00230 Purine metabolism
    Natpe_0082
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Natpe_0082
Enzymes [BR:npe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Natpe_0082
    5.4.2.8  phosphomannomutase
     Natpe_0082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AGB30028
UniProt: L0JGP9
Position
73727..75103
Genome map
AA seq 458 aa AA seqDB search
MEIFGSSGTRGVANEELTPAFVLRVAKAAGTIWAEDAGAERVGIARDTRYTGRMLADAAA
SGLASIGIDVDRLGIVPTPGAQTYAEHEAVPVIVVTASHNPPQYNGIKLVGADGVELSVA
TLETIEDRLLTESFTAAAWDETGRVREIDGVRRAYVEGLLAAVDRQPIADADLTVALDPG
HGAGALTSPEFFRELGCRVVTVNGQPDGHFPGRDPEPVPDNLADLGRLVRSTDADVGIAH
DGDADRAIFFDEDGEYVEGDATLAALAAAELEAGDTTVSAVNVSQRLVDVVNEVGADLEL
TPIGSTNIITRIRELEASGQRVPIAGEGNGGIFFPNYRLSRDGAFTAARFLELVAERPVS
EIVAPYDGYVNVRRNLEYESTAERDAMLDAAANQAKAADAELNTRDGYRLDYGDAWVLAR
PSGTEPLVRIYAEARDGDRAEELVDDMYEALADAKADA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggagatattcggatcgagcgggacgcggggcgtcgccaacgaggagttgacgcccgcg
ttcgtcctccgcgttgcgaaggcggcggggacgatctgggccgaggacgccggcgcggag
cgggtcgggatcgctcgcgacacccgctacaccggccgcatgctggccgatgcggccgcc
agtgggttagcgagcatcggcatcgacgtcgaccgactggggatcgttcctacccctggc
gcacagacctacgccgaacacgaggcggtcccagtgatcgtcgtcacggcctcgcacaac
ccaccccagtacaacgggatcaaactcgtcggggccgacggcgtcgaactctcggtcgcg
accctcgagaccatcgaggaccgactgctgaccgagtcgttcaccgcggccgcctgggac
gagacgggccgggtccgcgagatcgacggcgttcgccgggcctacgtcgaggggttgctc
gcggccgtcgaccgccagccgatcgccgacgcggacctgaccgtcgcgttggatcccggc
cacggcgcgggcgcgctgaccagccccgagttcttccgggaactgggctgtcgggtcgtt
accgtcaacggccagccggacggccacttccccggtcgtgaccccgaaccggtccccgac
aacctcgccgatctgggtcggctcgtccgatcgaccgacgccgacgtcgggatcgcccac
gacggcgacgccgaccgcgcgattttcttcgacgaggacggcgagtacgtcgagggcgac
gccacgctcgcggcgcttgcggccgccgaactcgaggccggcgacacgaccgtctcggcg
gtcaacgtctcccagcggctcgtcgacgtcgtgaacgaggtcggggccgacctcgaactc
accccgatcggttcgacgaacatcatcacccgcatccgcgaactcgaggcctcgggccag
cgggtcccgatcgccggcgagggcaacggcgggatcttcttcccgaactaccggctctcc
cgggacggggccttcaccgcggcccgattcctcgaactcgtggccgagcggccggtcagc
gagatcgtcgccccctacgacggctacgtcaacgtccggcgcaacctcgagtacgagtcg
acggcggaacgcgacgcgatgctcgatgcggccgccaatcaggccaaagcggccgacgcg
gaactcaacactcgagacggctaccggctggattacggcgatgcgtgggtgctggcccgc
ccctccggcaccgagccgctcgtccggatctacgccgaggcccgcgacggcgaccgtgcc
gaggaactcgtcgacgacatgtacgaggcgctggccgacgcgaaggccgacgcctga

DBGET integrated database retrieval system