KEGG   Natrinema pellirubrum: Natpe_0222Help
Entry
Natpe_0222        CDS       T02425                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
npe  Natrinema pellirubrum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Natpe_0222
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Natpe_0222
   00020 Citrate cycle (TCA cycle)
    Natpe_0222
   00620 Pyruvate metabolism
    Natpe_0222
Enzymes [BR:npe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Natpe_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
219902..221542
Genome map
AA seq 546 aa AA seqDB search
MVREFELPDVGEGVAEGELVSWLVEPGDEVTEDQPVAEVETDKALVEVPAPVDGTVRELH
VEAGEVVPVGTVIISFDVAGEETEGTAGQTESERETTSEHAGGDEPSEQPGDPGATGADA
EDVAPPDDRVFAPPRVRRMAREQGIALSSVRGSGPGGRITADDVRAAAGSETAGSQSQSA
DPAAGETASGTADSSGSSAAAGTAEETTTESAATATADSSARRHETPGQVESADRDKTLA
APATRRIAQEEGVDIDAIPTDEERDGEAFVTPEAVREYAAAQRQAQEADRESLEAGESVG
TTDADFAEGERERREPFTGVRKTIADAMVESKYSAPHVTHHDEVDVTELVAAREDLKPRA
EERGIRLTYMPFIMKAVIAALHEHPEMNAVIDEANEEIVYRDYYNIGVATATDVGLMVPV
IEDADRKGLLQLSSEMNEVVQKARDRTISPDELRGSTFTITNIGGIGGEYATPIINYPEA
GILAIGEIKRKPRVVTDEDGTESIEPRSVMTLSLSFDHRLIDGAVGAQFTNTVMEYLENP
HLLLLE
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggtcagggagttcgaactaccggacgtcggcgaaggggtcgcagagggcgaactggtc
tcgtggctggtcgaaccgggagacgaggtcactgaggaccagccggtcgcggaggtcgag
accgacaaggccctcgtcgaggttcccgcgccggtcgacggcacggtccgcgagttacac
gtcgaggctggcgaggtcgttcccgtcgggacggtgattatctcgttcgacgttgcaggt
gaggagaccgagggaactgcagggcagaccgaatcggagcgggagacaacgagcgaacac
gccggcggtgacgaaccgagcgagcagccgggcgatcccggtgcgaccggcgcagacgcc
gaggacgtcgcgccgccggacgaccgcgtcttcgcgcccccgcgcgtccgccgcatggcc
cgcgagcaggggatcgccctctcgagcgttcgggggagcggtcccggcgggcggattacc
gcggacgacgtgcgggccgcggcagggagcgaaacggcagggtcgcagtcccagagcgcc
gacccggcggcgggcgagaccgcatccgggacggccgattcgtccggaagcagcgccgcc
gctggtactgccgaggagactaccaccgagagcgcggcgacggcgaccgcggactcgagc
gcccggcgacacgagacgccggggcaggtcgagtccgcagaccgcgacaagacgctggcc
gcgcccgcaacccggcggatcgcccaggaagaaggcgtcgacatcgacgctatcccgact
gacgaggagcgcgacggcgaggcctttgtcacacctgaggcggtccgggagtacgctgcg
gcccagcgacaggcacaggaggccgaccgcgaatcgctcgaggcgggcgaatcggtcggg
acgacggacgctgacttcgccgagggcgagcgcgaacgtcgcgagccgtttacgggtgtc
cgcaagacgatcgccgacgcgatggtcgagtccaagtacagcgcgccccacgtcactcac
cacgacgaggtcgacgtgaccgaactcgtcgcggcccgggaggacctcaaaccgcgcgcc
gaggagcgtggcatccggctgacctacatgccgttcatcatgaaggccgtcatcgcggcg
ctgcacgaacaccccgagatgaacgccgtcatcgacgaggccaacgaggagatcgtctac
cgcgattactacaacatcggcgtcgcgaccgcgaccgacgtcggactgatggtaccggtg
atcgaggacgccgatcggaaggggctcttgcaactctcctcggagatgaacgaggtcgtc
cagaaggcccgcgaccggacgatcagtcccgacgaactccggggctcgacgtttaccatc
accaacatcggcggcatcggcggcgagtacgccacgccgatcatcaactaccccgaggcg
ggcatcctcgcgatcggggagatcaagcgcaaaccccgcgtcgtcaccgacgaggacggt
accgagtcgatcgaaccgcgttccgtgatgaccctctcgctgtcgttcgaccaccggctg
atcgacggtgcggtcggcgcacagtttacgaacaccgtcatggagtacctcgagaacccg
cacctactattgctcgagtaa

DBGET integrated database retrieval system