KEGG   Natrinema pellirubrum: Natpe_0464Help
Entry
Natpe_0464        CDS       T02425                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
npe  Natrinema pellirubrum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Natpe_0464
Enzymes [BR:npe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Natpe_0464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
453675..454523
Genome map
AA seq 282 aa AA seqDB search
MFPGAADDGEVTDAADAADRGVTNFVVVGAPLDATTTFQPGTRFGPDRIRSFAEPFDDYD
HRTDQHFSDLGVVDRGDVRAWNDVEAYLEYLTSTLREAVWDDAVPLTLGGEHTVSLAGAR
AVEPEVVVCCDAHLDLYDAYDGERFSHAAVTRRILEDVDSVEEVILLGVRTGSEGEWDRA
ADDDVTVVPPEDVGDWTPDGRLADREVYLSVDIDAADPGYAPGTGTKEPFGLEPRELRDV
VRDVAPQAGGFDVVEVNDRDDGQAAALAAKLVREFVFSHADG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccggggcggccgacgacggcgaggtgaccgacgcggcggacgctgccgaccgt
ggagtcacgaacttcgtggtcgtcggtgcgcccctggacgccacgacgacctttcagccg
gggaccagattcggtcccgaccggatccgttcgtttgccgaaccgttcgatgattacgat
caccggacggaccagcacttctccgacctgggcgtcgtcgatcgcggcgacgtccgtgcg
tggaacgacgtcgaagcctatctcgagtacctcacgagtacgctccgcgaggccgtttgg
gacgacgccgtcccgctgacgctgggtggcgaacacaccgtctcgctcgcgggcgcacgc
gcagtcgaacccgaggtggtcgtctgttgtgacgcccacctcgatctgtacgacgcctac
gacggcgagcggttctcacacgccgccgtcacccggcggatcctcgaggacgtcgactcg
gtcgaggaggtcatcctgctcggcgtccgcacgggcagcgagggcgagtgggaccgagcg
gccgacgacgacgtgaccgtcgtcccgcccgaggacgtgggcgactggacgcccgacggc
cggctcgcggaccgcgaggtctacctgagcgtcgacatcgacgccgccgaccccggctac
gcgccgggaacgggcacgaaagaaccgttcgggctcgagccccgcgaactccgcgacgtg
gtgcgggacgtggcaccgcaggccggcgggttcgacgtggtcgaggtcaacgaccgcgac
gacgggcaggcggccgcgctggccgcgaaactggttcgggagttcgtcttttcgcacgcc
gacgggtga

DBGET integrated database retrieval system