KEGG   Natrinema pellirubrum: Natpe_0658Help
Entry
Natpe_0658        CDS       T02425                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
npe  Natrinema pellirubrum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Natpe_0658
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Natpe_0658
   00052 Galactose metabolism
    Natpe_0658
   00500 Starch and sucrose metabolism
    Natpe_0658
   00520 Amino sugar and nucleotide sugar metabolism
    Natpe_0658
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Natpe_0658
   00524 Butirosin and neomycin biosynthesis
    Natpe_0658
Enzymes [BR:npe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Natpe_0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
649996..650973
Genome map
AA seq 325 aa AA seqDB search
MVYYAGVDLGATNVRAVVAEADGTRIGTNRRSTPRGPTGIDVTEGVLRTLRGACAEAGID
PQRIAATGIGSIGPFDLAEGAVIDPANLPDSIDRIPLTGPISELIGSDDVFLHNDTTAGV
IGERFHADRNPDDMVYVTISSGIGAGVCCDGEVVGGWDGNAGEVGHYVVDPRGRLTCGCG
HEGHWEAYCSGNAIPDYARLLAEDDPTISTSLPLEGPDFTAKDVFELAGEDELADYVIEQ
LAHWNAIGVTNVIHAFAPLVVSFGGAVALYNEELVVDPIRERVSEMVMTNVPEIRVTDQG
DDVVVEGALASALTEGTGDRRRLRE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggtctactatgcgggcgtcgatctcggtgcgaccaacgtccgggcggtcgtcgccgag
gccgacgggacgaggatcggcacgaaccgccgatcgacgccgcgcgggccgactggtatc
gacgtgacggagggcgtgctgcgaacgcttcggggggcgtgtgcggaggcggggatcgac
cctcagcggatcgccgcgaccggaatcgggtcgatcggaccgttcgacctcgccgaaggg
gcggtgatcgaccccgcgaacctccccgattcgatcgaccggatcccgctgaccgggccg
atttcggaactgatcggcagcgacgacgtcttcctccacaacgacaccaccgccggcgtc
atcggcgagcgttttcacgccgatcgcaaccccgacgacatggtctacgtgactatctcc
tcggggatcggtgccggcgtctgctgtgacggcgaggtcgtgggcggctgggacggcaac
gccggcgaggtcggccactacgtcgtcgatccgcgcggccgactgacctgtggctgcggt
cacgaaggtcactgggaggcctactgctcgggcaacgccatccccgactacgcccgcctg
ctggccgaggacgacccgacgatttcgacgagcctcccgctcgagggccccgacttcacc
gcgaaggacgtcttcgaactcgcgggcgaggacgaactggccgactacgtcatcgagcaa
ctggcccactggaacgcgatcggcgtcacgaacgtgatccacgccttcgccccgctcgtg
gtctccttcggcggcgcggtcgccctgtacaacgaggagctggtcgtcgatccgatccgc
gagcgcgtctcggagatggtgatgaccaacgtccccgagattcgcgtcaccgatcagggt
gacgacgtcgtcgtcgagggcgcgctcgcgagtgcgctcaccgagggcaccggcgaccgg
cggcgactgcgggagtga

DBGET integrated database retrieval system