KEGG   Natrinema pellirubrum: Natpe_0658Help
Entry
Natpe_0658        CDS       T02425                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
npe  Natrinema pellirubrum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:npe01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:npe00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:npe00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:npe00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:npe00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:npe00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
649996..650973
Genome map
AA seq 325 aa AA seqDB search
MVYYAGVDLGATNVRAVVAEADGTRIGTNRRSTPRGPTGIDVTEGVLRTLRGACAEAGID
PQRIAATGIGSIGPFDLAEGAVIDPANLPDSIDRIPLTGPISELIGSDDVFLHNDTTAGV
IGERFHADRNPDDMVYVTISSGIGAGVCCDGEVVGGWDGNAGEVGHYVVDPRGRLTCGCG
HEGHWEAYCSGNAIPDYARLLAEDDPTISTSLPLEGPDFTAKDVFELAGEDELADYVIEQ
LAHWNAIGVTNVIHAFAPLVVSFGGAVALYNEELVVDPIRERVSEMVMTNVPEIRVTDQG
DDVVVEGALASALTEGTGDRRRLRE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggtctactatgcgggcgtcgatctcggtgcgaccaacgtccgggcggtcgtcgccgag
gccgacgggacgaggatcggcacgaaccgccgatcgacgccgcgcgggccgactggtatc
gacgtgacggagggcgtgctgcgaacgcttcggggggcgtgtgcggaggcggggatcgac
cctcagcggatcgccgcgaccggaatcgggtcgatcggaccgttcgacctcgccgaaggg
gcggtgatcgaccccgcgaacctccccgattcgatcgaccggatcccgctgaccgggccg
atttcggaactgatcggcagcgacgacgtcttcctccacaacgacaccaccgccggcgtc
atcggcgagcgttttcacgccgatcgcaaccccgacgacatggtctacgtgactatctcc
tcggggatcggtgccggcgtctgctgtgacggcgaggtcgtgggcggctgggacggcaac
gccggcgaggtcggccactacgtcgtcgatccgcgcggccgactgacctgtggctgcggt
cacgaaggtcactgggaggcctactgctcgggcaacgccatccccgactacgcccgcctg
ctggccgaggacgacccgacgatttcgacgagcctcccgctcgagggccccgacttcacc
gcgaaggacgtcttcgaactcgcgggcgaggacgaactggccgactacgtcatcgagcaa
ctggcccactggaacgcgatcggcgtcacgaacgtgatccacgccttcgccccgctcgtg
gtctccttcggcggcgcggtcgccctgtacaacgaggagctggtcgtcgatccgatccgc
gagcgcgtctcggagatggtgatgaccaacgtccccgagattcgcgtcaccgatcagggt
gacgacgtcgtcgtcgagggcgcgctcgcgagtgcgctcaccgagggcaccggcgaccgg
cggcgactgcgggagtga

DBGET integrated database retrieval system