KEGG   Natrinema pellirubrum: Natpe_0658Help
Entry
Natpe_0658        CDS       T02425                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
npe  Natrinema pellirubrum
Pathway
npe00010  Glycolysis / Gluconeogenesis
npe00052  Galactose metabolism
npe00500  Starch and sucrose metabolism
npe00520  Amino sugar and nucleotide sugar metabolism
npe00521  Streptomycin biosynthesis
npe01100  Metabolic pathways
npe01110  Biosynthesis of secondary metabolites
npe01120  Microbial metabolism in diverse environments
npe01130  Biosynthesis of antibiotics
npe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Natpe_0658
   00052 Galactose metabolism
    Natpe_0658
   00500 Starch and sucrose metabolism
    Natpe_0658
   00520 Amino sugar and nucleotide sugar metabolism
    Natpe_0658
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Natpe_0658
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Natpe_0658
Enzymes [BR:npe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Natpe_0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: AGB30583
UniProt: L0JIA5
Position
649996..650973
Genome map
AA seq 325 aa AA seqDB search
MVYYAGVDLGATNVRAVVAEADGTRIGTNRRSTPRGPTGIDVTEGVLRTLRGACAEAGID
PQRIAATGIGSIGPFDLAEGAVIDPANLPDSIDRIPLTGPISELIGSDDVFLHNDTTAGV
IGERFHADRNPDDMVYVTISSGIGAGVCCDGEVVGGWDGNAGEVGHYVVDPRGRLTCGCG
HEGHWEAYCSGNAIPDYARLLAEDDPTISTSLPLEGPDFTAKDVFELAGEDELADYVIEQ
LAHWNAIGVTNVIHAFAPLVVSFGGAVALYNEELVVDPIRERVSEMVMTNVPEIRVTDQG
DDVVVEGALASALTEGTGDRRRLRE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggtctactatgcgggcgtcgatctcggtgcgaccaacgtccgggcggtcgtcgccgag
gccgacgggacgaggatcggcacgaaccgccgatcgacgccgcgcgggccgactggtatc
gacgtgacggagggcgtgctgcgaacgcttcggggggcgtgtgcggaggcggggatcgac
cctcagcggatcgccgcgaccggaatcgggtcgatcggaccgttcgacctcgccgaaggg
gcggtgatcgaccccgcgaacctccccgattcgatcgaccggatcccgctgaccgggccg
atttcggaactgatcggcagcgacgacgtcttcctccacaacgacaccaccgccggcgtc
atcggcgagcgttttcacgccgatcgcaaccccgacgacatggtctacgtgactatctcc
tcggggatcggtgccggcgtctgctgtgacggcgaggtcgtgggcggctgggacggcaac
gccggcgaggtcggccactacgtcgtcgatccgcgcggccgactgacctgtggctgcggt
cacgaaggtcactgggaggcctactgctcgggcaacgccatccccgactacgcccgcctg
ctggccgaggacgacccgacgatttcgacgagcctcccgctcgagggccccgacttcacc
gcgaaggacgtcttcgaactcgcgggcgaggacgaactggccgactacgtcatcgagcaa
ctggcccactggaacgcgatcggcgtcacgaacgtgatccacgccttcgccccgctcgtg
gtctccttcggcggcgcggtcgccctgtacaacgaggagctggtcgtcgatccgatccgc
gagcgcgtctcggagatggtgatgaccaacgtccccgagattcgcgtcaccgatcagggt
gacgacgtcgtcgtcgagggcgcgctcgcgagtgcgctcaccgagggcaccggcgaccgg
cggcgactgcgggagtga

DBGET integrated database retrieval system