KEGG   Natrinema pellirubrum: Natpe_0861Help
Entry
Natpe_0861        CDS       T02425                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
npe  Natrinema pellirubrum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Natpe_0861
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Natpe_0861
Enzymes [BR:npe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Natpe_0861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
848470..849312
Genome map
AA seq 280 aa AA seqDB search
MRTMREELEESGVEEARRLAADADRVIVKAGTNSLTDEDSNLDDGKLDKLVDDLEDLLKR
DKEVILVSSGSIGAGTGRIEQSSGTVEESQALSTVGQSLLMHRYTESFDRYDRKVAQLLL
TQHDLENPERFTNLRNTIETLLDWGVVPIINENDAVATEEIRIGDNDMLSAATTMGVDAD
LLVTLTDVGGVYTGNPKEDDDAERIDAVGTNYDDVQGIISETTSDGFGGIKTKVEGARDV
SEHGVPAVIAKSTAPDVLEKIATAKPVGTIFVPINGVSDD
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgatgcgtgaggaactcgaggagtctggcgtcgaggaagcacgccggctggcg
gccgacgccgaccgggtgatcgtcaaggccgggaccaactccctgaccgacgaggactcg
aatctcgacgacgggaaactcgacaagctcgtcgacgacctcgaggacctcctgaagcgg
gacaaagaagtcattctcgtctcctcgggctcgatcggggccgggacgggtcgaatcgaa
cagtcgagcggcaccgtcgaggagtcccaggccctctcgaccgtcggccagagcctcctc
atgcaccgctatacggagagcttcgaccgctacgaccgaaaggtcgcacaactgctcttg
acccagcacgacctcgagaaccccgaacgattcacgaacctgcggaacacgatcgagacg
ctgctcgactggggcgtcgtcccgatcatcaacgagaacgacgccgtcgcgaccgaggag
atccgaatcggcgacaacgacatgctctcggcggcgacgacgatgggcgtcgacgccgat
ctgttagtgacgctgaccgacgtcggcggcgtctacaccggcaacccgaaggaagacgac
gacgccgagcgcatcgacgccgtcggcaccaactacgacgacgttcaagggatcatcagc
gagaccacgtccgacggcttcggcggcatcaagaccaaggtcgagggggcacgcgacgtc
agcgaacacggcgtcccggcggtcatcgcgaagtcgaccgcccccgacgtcctcgagaag
atcgctactgccaagcccgtgggtaccatattcgttcccatcaacggtgtgagcgatgac
tga

DBGET integrated database retrieval system