KEGG   Natrinema pellirubrum: Natpe_0944Help
Entry
Natpe_0944        CDS       T02425                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
npe  Natrinema pellirubrum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Natpe_0944
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Natpe_0944
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Natpe_0944
Enzymes [BR:npe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Natpe_0944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
916332..917525
Genome map
AA seq 397 aa AA seqDB search
METTDAFAGLECVDCGTVIEATAEAHRCPECDGPLDPRYDYDAIDLDRETLEGRPADSQW
RYAELLPFTRETAVTTREGATPLVDCPDLADELGVERVLLKDEGRNPTGSVRDRGASVAV
TAATQSDADDVALPSTGNGGQAAAAYAGRAGLESHAYLPSRSGFTNKAMVNVHGGDMNVV
GGRYGDAVGAFEEALAEHDDWYSLRAFETPYRHEGIKTLFYELVEDLEWDVPDAICYPTG
IGTGIVGLAKAAREFEELGLIDETPALYAAQASGCAPIADAVADGRDDLDPVERPDTICG
ELEIPDPPAGSWVLEALRETDGDAVATDDPDILEAAVRVAQTTGLEPTPSAAAAASGAWE
LADRGAFDGDETVVIVSTGAGNKEADVLRSHLMGQGI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggagacgactgacgccttcgcggggctcgagtgcgtcgactgcgggaccgtcatcgag
gctaccgccgaggcccaccgatgtcccgagtgtgacggtccgctcgacccgcgctacgat
tacgacgcgatcgacctcgatcgcgagacgctcgagggtcggccggccgactcgcagtgg
cgctacgccgaactgctgccgtttacccgcgaaacggcggtcacgacccgagagggcgcg
acgccgctggtcgactgtcccgacctggccgacgaactcggcgtcgagcgggtcctgctc
aaagacgaaggccggaacccgacgggctcggtccgcgaccgcggcgcgtcggttgcggtc
acggcggcgacccaaagcgacgccgacgatgtcgcgctcccgtcgaccggcaacggcggc
caggccgcggcggcctacgcgggccgggccggcctcgagtcccacgcttacctcccctcg
cgctcgggctttacgaacaaggcgatggtcaacgtccacggcggcgacatgaacgtcgtc
ggcggccgctacggcgacgccgtcggcgcgttcgaagaggcgctcgccgaacacgacgac
tggtactcgctgcgagccttcgagacgccctatcgccacgaggggatcaagacgctgttc
tacgaactcgtcgaagacctcgagtgggacgtgccggacgcgatctgttacccgacgggg
atcgggacggggatcgtcggcctcgccaaggccgcccgcgaattcgaggaactggggctg
atcgacgagacgcccgcactctacgccgcgcaggcctctggctgtgccccgatcgcggac
gccgtcgccgacggccgcgacgacctcgatcccgtcgagcgccccgacaccatctgtggc
gaactcgagattccggacccgccggccggctcgtgggtcctcgaggcgctccgggagacc
gacggcgacgcggtcgcgaccgacgatcccgacatcctcgaggcggccgtgcgggtggcc
cagacgaccggcctcgagccgaccccgagcgcggcggcggccgccagcggcgcgtgggaa
ctcgccgaccgcggtgcgttcgacggcgacgagacggtcgtgatcgtctcgacgggcgcg
ggcaacaaggaggccgacgtgttgcgcagccatctgatgggacagggcatttag

DBGET integrated database retrieval system