KEGG   Natrinema pellirubrum: Natpe_1013Help
Entry
Natpe_1013        CDS       T02425                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
npe  Natrinema pellirubrum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Natpe_1013
Enzymes [BR:npe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Natpe_1013
Exosome [BR:npe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Natpe_1013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
992667..994208
Genome map
AA seq 513 aa AA seqDB search
MTDTTYVGAVDQGTTGTRFIVFDHEGQVVANAYETHEQIYPEPGWVEHDPMEIWENTKAV
IQQALGQAGISPSQLAAIGVTNQRETTVLWDADSGKPVHNAIVWQDRRTTDRVEALEEEG
KVEAIREKTGLEADAYFSATKAEWLLDNADPIKLERARPEDIRDRAEKGDVLFGTIDTWL
IYNLTGNHVTEVTNASRTMLYDIHDLEWDDDLLEEFSIPEAMLPEVRPSSDDDTYGTTDP
DGFLEAEVPVAGALGDQQAALFGQTCFDAGDAKNTYGTGSFFLMNTGDEAVESDHGLLTT
IGFQRSGEPVQYALEGSIFVTGAAIEWLEDMTLIEDPAETAELARSVDSTDGVYVVPAFT
GLGAPHWDQRARGTIVGMTRGTRKEHVVRATLESIAYQTRDVAEAMEADSGIEMRSLKVD
GGAVKNNYLCQLQSDIIGSEIVRPVVDETTALGSAYAAGLAVGYWDDPDELRSNWQVDAE
FEPEMDPDRADRRYERWNDAVKRSRDWARDEED
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtgacagacacaacgtacgtcggagcggtcgaccagggaacgaccgggacccggtttatc
gtgttcgatcacgagggtcaggtcgtcgcgaacgcctacgagacacacgaacagatctac
cccgagcccggctgggtcgaacacgacccgatggagatctgggagaacaccaaggccgtg
atccagcaggcgctcggacaggcgggaatctccccgtcccagctcgcagccattggcgtg
accaaccagcgggagacgacggttctctgggacgccgacagcgggaaaccggtccacaac
gccatcgtctggcaggaccgccgaaccaccgatcgcgtcgaggccctcgaggaggaggga
aaagtcgaggcgatccgcgagaagaccggcctcgaggccgacgcctacttctcggcgacg
aaggccgaatggctgctcgataacgccgatccgatcaaactcgagcgcgcccggcccgag
gacatccgcgaccgggcggagaaaggcgacgtgttgttcgggacgatcgacacgtggttg
atctacaacctgaccgggaaccacgtcaccgaggtcacgaacgcctcgcggacgatgttg
tacgacatccacgacctcgaatgggacgacgacctgctcgaggagttctcgatccccgag
gcgatgttgcccgaggtccggccctccagcgacgacgacacctacggcacgaccgacccc
gacgggttcctcgaggccgaggtgccggtcgcgggcgcgctgggcgaccagcaggccgcg
ctgttcggccagacctgtttcgacgccggcgacgccaagaacacctacggcaccggctcc
ttcttcctgatgaacaccggtgacgaggccgtcgagagcgaccacgggctgctgacgacg
atcgggttccagcgctcgggcgaaccggtccagtacgcactcgagggctcgatcttcgtc
accggcgcggccatcgagtggctcgaggacatgacgctgatcgaggaccccgccgagacg
gcggaactggcccgcagcgtcgactcaacggacggcgtctacgtcgtccccgcctttacc
gggctgggcgcaccccactgggaccaacgggcccgcggcaccatcgtcgggatgacccgt
ggcacccggaaagaacacgtcgttcgcgcgacgctcgagtcgatcgcctaccagactcgc
gacgtcgccgaggcgatggaggccgactcgggcatcgagatgcgatcgctgaaggtcgac
ggcggcgcggtcaagaacaactacctctgtcaactccagtccgatatcatcggctcggag
atcgtccgccccgtcgtcgacgagacgacggcgctgggctcggcctacgcggccggcctc
gccgtcggctactgggacgaccccgacgagttgcggagcaactggcaggtcgacgccgag
ttcgagcccgagatggatcccgaccgcgcggaccgacgatacgaacgatggaacgacgcc
gtcaagcgctcgcgcgactgggcgcgtgacgaggaggactaa

DBGET integrated database retrieval system