KEGG   Natrinema pellirubrum: Natpe_1311Help
Entry
Natpe_1311        CDS       T02425                                 

Definition
nucleoside-diphosphate-sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
npe  Natrinema pellirubrum
Brite
Enzymes [BR:npe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Natpe_1311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1298264..1299238
Genome map
AA seq 324 aa AA seqDB search
MSADAPTAAVTGATGFLGSHLCEQLLADGWIVRGLCRPTSERGDLAGVDWHVGDLSDGET
LRELVDGADVVFHLAGIGLWSAGPATIWAVNRDGTERLLAACRDGDVGRVVFTSTAGTRR
PAGDDAFADETDVAEPVGAYQASKAAAEELVDDYAANGGDAVTVHPTSIFGPGDEAFTAQ
LLAMGVEPTMPAHLPGGLSIVGVADVVDGLLAAVERGESGDHYILGGENLTYDRAVSRIA
ETVDGSPARIRVPATAIRAAGPVAEVVDAVADRRVFPFDRDMAEMATQRLFYTSRKANEE
LGYEYQPLEAHVPEAMEWYRAAVQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgccgacgcccccactgcggcggtcaccggcgcgacggggtttctcggctcgcac
ctctgcgagcagctgctggcggatggctggatcgttcgtggcctctgccggccgacgtcg
gagcggggcgacctcgcaggcgtcgactggcacgtcggcgatctctccgacggggaaacg
ctgcgagaactcgtcgacggcgcggacgtggtctttcacctcgcggggatcggactctgg
agcgccggcccggcgacgatctgggcggtcaaccgcgacggcaccgagcggctcctcgcg
gcctgtcgcgatggtgacgtgggtcgcgtcgtgttcaccagcacggccggcacgcgccgc
cctgcgggcgacgacgcgttcgccgacgagaccgacgtggccgagccggtcggggcctac
caggcttcgaaggccgccgccgaggagttggtcgacgactacgccgccaacggcggcgac
gccgtcaccgtccatccgacctcgatcttcggtcccggcgacgaggcgtttacggcacag
ttgctcgcgatgggcgtcgagccgacgatgccggcccacctccccggcgggctgagtatc
gtcggcgtcgccgacgtcgtcgacgggctgctggcagcggtagagcgcggcgagagcggc
gaccactacatcctcggcggcgagaacctcacctacgaccgcgccgtttcccggatcgcc
gagaccgtcgacggctctcccgcgcggatccgcgtccccgcgaccgcgatccgcgccgcc
ggccccgtcgccgaggtcgtcgacgccgtcgccgaccgccgggtgttccccttcgatcgc
gacatggccgagatggcgacccaacggctgttctacacctcaagaaaggccaacgaggag
ttagggtacgagtatcagcccctcgaggcccacgtccccgaagccatggaatggtatcgg
gcggcggtgcagtag

DBGET integrated database retrieval system