KEGG   Natrinema pellirubrum: Natpe_1450Help
Entry
Natpe_1450        CDS       T02425                                 

Definition
histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
npe  Natrinema pellirubrum
Brite
Enzymes [BR:npe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Natpe_1450
Transfer RNA biogenesis [BR:npe03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Natpe_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1433542..1435203
Genome map
AA seq 553 aa AA seqDB search
MSTETPEPTETEAFERVCETLVERILAGEIERDEVEKAKLEACSEHSAPKVPKNSELLDY
APEEHREDLEAVLQRKPVRTASGVSPVAIMTSPERCPHGKCLYCPGGPDSEFSSSQSYTG
EEPAAARGVQNDYDPYGQVTLRLEQLRQIGHPVDKVELILMGGTMTARSHDYQEWFVKRA
LEAMNDYDVDKEPEPAQGVSFAEDPEEYEWQYLEDVIAENETADVRNIGTTFETKPDWCD
PEQIDRMLELGGTKVEVGVQTTFERINREMHRGHGAQASIDANRRLRDSAFKVGFHMMPG
QPGMSKEMCLEDFRRLFEEEQWKPDYLKIYPTLIVRGTATYDWWHNGEFEPLGNDEAAEL
IAEIKDMIPRYTRLQRVQRDIPADFIDAGVWKSNLRQLARKRMDEHGWSCDCIRCREAGM
NDEDAENVDLDVLTYEACGGTEHFISFEDFQKDLLVGFCRLRFPNDPVRPELENAALIRE
LHVYGSEVAMGDESETDQHQHQGYGRRLMNRAEDLAVDAGYDKLSVISGIGAREYYRNKL
GYHQDGPYVSKRL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgagacgcccgaaccgaccgaaaccgaagcgttcgagcgggtctgtgagacg
ctcgtcgagcggatcctcgccggcgagatcgagcgcgacgaggtcgagaaagcgaagctc
gaggcctgttcggaacactcggcacccaaggtgccgaagaactccgagttgctggactac
gcgcccgaggaacaccgcgaggatctggaagcggtgttacagcgcaaacccgtccgcacc
gcctcgggcgtctcgccggtcgcgatcatgacctcgcccgagcgctgtccccacgggaag
tgtctctactgtcccggcggccccgactcggagttctcgagttcccagagctacacgggc
gaggagcccgccgccgcccgcggcgtccagaacgactacgatccctacgggcaggtcacg
ctccgactcgagcagctgcgccagatcggccaccccgtcgacaaggtcgaactcatcctg
atgggcgggacgatgaccgcccgcagccacgactaccaggagtggttcgtcaagcgtgcc
ctcgaggcgatgaacgactacgacgtcgacaaggagccggaaccggctcagggcgtcagc
ttcgccgaggaccccgaagaatacgagtggcagtacctcgaggacgtcatcgccgagaac
gagacggccgacgtccgcaacatcgggacgaccttcgagaccaagcccgactggtgcgat
ccggaacagatcgaccggatgctcgagctgggcgggacgaaagtcgaggtcggcgtccag
acgaccttcgagcggatcaaccgggagatgcaccggggccacggtgcgcaggcgtcgatc
gacgccaaccgccggctccgggactcggcgttcaaggtcggcttccacatgatgcccggc
cagcccggaatgagcaaggagatgtgtctcgaggacttccggcggctcttcgaggaggag
cagtggaagccggactacctgaagatctatccgacgctgatcgtccggggaacggcgacc
tacgactggtggcacaacggcgagttcgaaccgctgggcaacgacgaggccgcggagctg
atcgccgagatcaaggacatgattccccggtacacgcgactccagcgcgtccagcgggac
atccccgcggacttcatcgatgccggcgtctggaagtccaatctccgccaactcgcccgc
aagcgcatggacgaacacggctggtcttgtgactgtatccgttgtcgcgaagcggggatg
aacgacgaggacgccgagaacgtcgacctcgacgtgttgacctacgaggcctgcggcggc
accgagcatttcatttccttcgaggacttccagaaggacctgctggtcggcttctgcagg
ctccggttccccaacgaccctgtccgcccggaactcgagaacgccgcgttgatccgggaa
ctgcacgtctacggctccgaggtcgccatgggcgacgagagcgagacggatcaacatcag
catcagggctacggccgccggctaatgaatcgcgccgaggacctcgcggtcgacgccggc
tacgacaaactgagcgtcatctccggcatcggcgcgcgggagtactaccggaacaaactc
ggctaccatcaggacggcccgtacgtgagcaaacgtctctag

DBGET integrated database retrieval system