KEGG   Natrinema pellirubrum: Natpe_1504Help
Entry
Natpe_1504        CDS       T02425                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
npe  Natrinema pellirubrum
Pathway
npe00220  Arginine biosynthesis
npe00330  Arginine and proline metabolism
npe01100  Metabolic pathways
npe01110  Biosynthesis of secondary metabolites
npe01130  Biosynthesis of antibiotics
npe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Natpe_1504
   00330 Arginine and proline metabolism
    Natpe_1504
Enzymes [BR:npe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Natpe_1504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AGB31406
UniProt: L0JM17
Position
complement(1480881..1481801)
Genome map
AA seq 306 aa AA seqDB search
MDRTVRIIGAPMDYGANRRGVDMGPSAIRYADLADRLAEADVEPVDDGDLTMPRAEERDP
DADQPTDGNAKFLREVEDVCRRVSDRVAATLADGEFPLVLGGDHSVAIGSLAGSAREADL
GAIWFDAHADINTPETSPSGNVHGMPLAAALGHGSFGETEWAPAPRLQASSIAYVGLRSI
DDRERELLRESELTVFTMSDIDQRGVSSVVEDALAVATDGTDGVHVSLDLDWLDPKTAPG
VGTPVRGGVTYREAHAALEALSRRDRADDVLRSMDVVEVNPILDEGNETATLAAELTAST
FGKRIF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggaccgaaccgtcaggatcattggcgcgccgatggactacggggcgaaccgccggggg
gtcgacatgggaccgtccgcgatccgatacgcggatctggccgaccgactcgccgaggcg
gacgtcgaacccgtcgacgacggcgacctgacgatgccccgggcagaagaacgggatccg
gacgccgaccagcccaccgacgggaacgcgaagttcctccgggaggtcgaagacgtctgt
cggcgagtgagcgaccgcgtcgcggcgacgctcgcggacggggagttccccctcgttctc
ggtggcgaccactcggttgcgatcggctcactggcggggtcggcacgcgaggccgatctc
ggcgcgatctggttcgacgcccatgccgacatcaatacgcccgagacctcgcccagcggc
aacgtccacgggatgccgctggccgcggcgcttggccacgggtcgttcggcgagacggag
tgggctcccgccccccggctccaggcgtcttcgatcgcgtacgtcggtctccggagcatc
gacgatcgcgaacgcgaactgctccgggagagcgaactgaccgtctttaccatgtccgac
atcgatcagcggggcgtctcgtccgtcgtcgaggacgcgctcgctgtcgcgaccgacggg
accgacggcgtccacgtcagcctcgacctcgactggctcgatcccaagaccgcgcccggc
gtcggcacccccgtccgcggcggcgtcacctaccgggaggcccacgccgccctcgaggcc
ctctcgcggcgcgaccgcgcggacgacgtcctcagatcgatggacgtcgtcgaggtcaac
ccgatcttggacgagggcaacgagacggcgacgctggcagccgaactgaccgcgagtacg
ttcggcaagcgcatcttctga

DBGET integrated database retrieval system