KEGG   Natrinema pellirubrum: Natpe_1542Help
Entry
Natpe_1542        CDS       T02425                                 

Definition
succinyl-CoA synthetase, beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
npe  Natrinema pellirubrum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Natpe_1542
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Natpe_1542
   00640 Propanoate metabolism
    Natpe_1542
   00660 C5-Branched dibasic acid metabolism
    Natpe_1542
Enzymes [BR:npe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Natpe_1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1519491..1520642
Genome map
AA seq 383 aa AA seqDB search
MKLHEYQAKQVFADAGVPTPDSQLASDVDGVVAAAEEIGYPVAVKAQVQVGGRGKAGGIK
LAEDEDEAREAAESILGMDLKGYHVDRVLVEEAVDFVNELYVGITMDRGEGKPVAMVSTK
GGVNIEEVAEEDPEAIAREHIDPAFGMHPYQARKAVYDAGVDQSIARDVSSVLTTLYELW
DEKDGADAEINPLMVTSDNEVIAADAVMNIDEDALFRQPELAEMEEEAAGGDELEQKADE
YGFDYVRLDGNVGIIGNGAGLVMTTLDLVDYYGGEPANFLDVGGGAKAARIANALDMVFS
DDNVDSVVFNIFGGITRGDEVARGINEALEQFDEIPKPVVVRLAGTNWEEGMEILNEDLV
TVDQTLEGAVQRAVEYADEVNEQ
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacgagtaccaggcgaagcaggtcttcgccgatgccggggtaccgacgccg
gactcgcagctcgcgtccgacgtcgacggcgtcgtcgccgcggccgaggagatcggctat
ccagtcgcggtcaaggcgcaagtacaggtcggcggccgggggaaggccggcggaatcaaa
ctcgccgaggacgaggacgaggcccgcgaggctgccgagtctatcctcgggatggacctg
aagggctaccacgtggaccgcgttctcgtcgaggaagcggtcgacttcgtgaacgaactc
tacgtcgggatcacgatggaccgcggcgagggcaaaccagtcgcgatggtctcgaccaag
ggcggggtcaacatcgaagaggtcgccgaggaggaccccgaggcgatcgcccgcgaacac
atcgaccccgcgttcgggatgcatccctaccaggcccgcaaggccgtctacgacgccggc
gtcgaccagtcgatcgcgcgtgacgtctcgagcgtcctgacgacgctgtacgaactctgg
gacgagaaagacggcgccgacgccgagatcaacccgctgatggtcaccagcgataacgag
gtcatcgcggccgacgccgtgatgaacatcgacgaggatgcgctgttccgccagcccgaa
ctcgccgagatggaagaggaagcggccggcggcgacgaactcgagcagaaggccgacgag
tacggcttcgactacgtccgactcgacggcaacgtcggcatcatcggcaacggtgccggg
ctcgtgatgacgacgctggatctggtcgactactacggcggcgaacccgccaacttcctc
gacgtgggcggcggcgcgaaggccgcccgcatcgcgaacgcgctcgatatggtcttctcc
gacgacaacgtcgactcggtcgtcttcaatatcttcggcggcatcacgcgcggcgacgag
gtcgcccgcgggatcaacgaggccctagagcagttcgacgagatccccaagccggtcgtc
gtccgactggccggcaccaactgggaggaaggcatggagattctgaacgaggacctcgtg
acggtcgatcagaccctcgagggtgcggtccagcgtgctgtcgaatacgctgacgaggtg
aacgaacaatga

DBGET integrated database retrieval system