KEGG   Natrinema pellirubrum: Natpe_1542Help
Entry
Natpe_1542        CDS       T02425                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
npe  Natrinema pellirubrum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Natpe_1542
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Natpe_1542
   00640 Propanoate metabolism
    Natpe_1542
   00660 C5-Branched dibasic acid metabolism
    Natpe_1542
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Natpe_1542
Enzymes [BR:npe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Natpe_1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1519491..1520642
Genome map
AA seq 383 aa AA seqDB search
MKLHEYQAKQVFADAGVPTPDSQLASDVDGVVAAAEEIGYPVAVKAQVQVGGRGKAGGIK
LAEDEDEAREAAESILGMDLKGYHVDRVLVEEAVDFVNELYVGITMDRGEGKPVAMVSTK
GGVNIEEVAEEDPEAIAREHIDPAFGMHPYQARKAVYDAGVDQSIARDVSSVLTTLYELW
DEKDGADAEINPLMVTSDNEVIAADAVMNIDEDALFRQPELAEMEEEAAGGDELEQKADE
YGFDYVRLDGNVGIIGNGAGLVMTTLDLVDYYGGEPANFLDVGGGAKAARIANALDMVFS
DDNVDSVVFNIFGGITRGDEVARGINEALEQFDEIPKPVVVRLAGTNWEEGMEILNEDLV
TVDQTLEGAVQRAVEYADEVNEQ
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacgagtaccaggcgaagcaggtcttcgccgatgccggggtaccgacgccg
gactcgcagctcgcgtccgacgtcgacggcgtcgtcgccgcggccgaggagatcggctat
ccagtcgcggtcaaggcgcaagtacaggtcggcggccgggggaaggccggcggaatcaaa
ctcgccgaggacgaggacgaggcccgcgaggctgccgagtctatcctcgggatggacctg
aagggctaccacgtggaccgcgttctcgtcgaggaagcggtcgacttcgtgaacgaactc
tacgtcgggatcacgatggaccgcggcgagggcaaaccagtcgcgatggtctcgaccaag
ggcggggtcaacatcgaagaggtcgccgaggaggaccccgaggcgatcgcccgcgaacac
atcgaccccgcgttcgggatgcatccctaccaggcccgcaaggccgtctacgacgccggc
gtcgaccagtcgatcgcgcgtgacgtctcgagcgtcctgacgacgctgtacgaactctgg
gacgagaaagacggcgccgacgccgagatcaacccgctgatggtcaccagcgataacgag
gtcatcgcggccgacgccgtgatgaacatcgacgaggatgcgctgttccgccagcccgaa
ctcgccgagatggaagaggaagcggccggcggcgacgaactcgagcagaaggccgacgag
tacggcttcgactacgtccgactcgacggcaacgtcggcatcatcggcaacggtgccggg
ctcgtgatgacgacgctggatctggtcgactactacggcggcgaacccgccaacttcctc
gacgtgggcggcggcgcgaaggccgcccgcatcgcgaacgcgctcgatatggtcttctcc
gacgacaacgtcgactcggtcgtcttcaatatcttcggcggcatcacgcgcggcgacgag
gtcgcccgcgggatcaacgaggccctagagcagttcgacgagatccccaagccggtcgtc
gtccgactggccggcaccaactgggaggaaggcatggagattctgaacgaggacctcgtg
acggtcgatcagaccctcgagggtgcggtccagcgtgctgtcgaatacgctgacgaggtg
aacgaacaatga

DBGET integrated database retrieval system