KEGG   Natrinema pellirubrum: Natpe_1758Help
Entry
Natpe_1758        CDS       T02425                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
npe  Natrinema pellirubrum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:npe01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:npe00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1729037..1729993)
Genome map
AA seq 318 aa AA seqDB search
MTTPTDARIDHPNRSTTRTVRLLGAPLDLGADRRGVDIGPRAIRYADIAGELETAGVACT
DSGDLRVPRLEQCNVPDTEDDAKYLDEIADVTAELADEVADTIADGDVPIALGGDHATAM
GTIRGAARAADIGVLWFDAHGDYNTPDTSPSGNVHGMPLAAVTGTGEFDGLDWTTTPTVA
PSNTVIVGARRLDNAERTALKESDVTVFTMHDIDERGITAVVEDALDIATDGVDGVHVSL
DLDWLDPTVAPGVGTPVRGGVEYREAHAALECVADRDRDAELLRSVDIVEVNPILDRNNR
TAEVAAELAASLLGKRIA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaccaacggacgccagaatcgaccacccgaaccgatcgacgactcgaaccgtt
cgcctgctcggcgcgccgctcgatctcggagcggatcggcgcggcgtcgacatcggaccg
cgagccatccggtacgcggatattgccggcgaactcgagacagccggcgttgcttgcacc
gattccggagatctacgtgtcccccgactcgagcagtgtaatgtcccggatacggaagac
gatgcgaagtatctcgacgagatcgccgatgtcaccgccgaactcgcggacgaggtcgcc
gacacgattgcggacggtgacgttccgatcgctctgggcggcgatcacgcgactgcgatg
ggaaccatccgcggcgcagcacgagcggcggacatcggggttctctggttcgacgcccac
ggggactacaacacacccgacacctctcccagcggcaacgtccacgggatgcccctggca
gccgtcactggcaccggtgagttcgacggactcgactggacgacgacgccgaccgtcgcc
ccgtcaaatacggtcatcgtcggcgcacgacgtcttgacaacgccgagcgaaccgccctc
aaggaaagtgacgtaaccgtgttcacgatgcacgacatcgacgaacgcggtatcaccgcc
gtcgtcgaggacgcgctcgatatcgcaaccgacggcgtggacggggttcacgtcagcctc
gatctcgactggctcgacccgacggtcgcaccgggcgtcggaacacccgttcgcggcggc
gtcgaatacagggaagcccacgctgcactcgagtgcgttgccgaccgcgaccgcgacgcg
gagctacttcgctcggtcgatatcgtcgaggtgaatccgattctcgatcgaaacaaccgc
accgcggaagtcgcagccgaactcgccgccagtcttctcggcaaacggatagcgtaa

DBGET integrated database retrieval system