KEGG   Natrinema pellirubrum: Natpe_2388Help
Entry
Natpe_2388        CDS       T02425                                 

Definition
asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
npe  Natrinema pellirubrum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Natpe_2388
Enzymes [BR:npe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Natpe_2388
Peptidases [BR:npe01002]
 Cysteine Peptidases
  Family C44
   Natpe_2388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2327901..2329043)
Genome map
AA seq 380 aa AA seqDB search
MTDELRGDPATVRDAIERADPLPGGTGFSGRVDGRLVRDILGREPLFVDADDSADEERAW
SFEPAPLEDPVLFPAGAATSPADPLPEPESYWSLPDPEPYAPERALASLERAVETAADAA
LGTDHDIAVAFSGGVDSALVAELLDAPLYVVGFPDSHDVEAARTAADAMGRELTVVELEP
ADLERAVPEVVRATGRTNAMDVQIALPLYLVGERVAADGFDALAVGQGADELFGGYEKVV
RLDHRVDAETVRGAVREGIRSLPDQLPRDVLTIEATGLEPVAPLLHDAVIEAALRLPDEL
LADTEERKRGFRRVAAEHLPAEVAQRDKKAVQYGSLVARELDRLARQAGYKRRIDDHVDK
YVAALCSDGPTERDSSTTSS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgaactgcgcggcgacccggcgaccgtccgcgacgccatcgagcgggccgat
ccgctgcccggtggcaccggattctccgggcgcgtcgacggccgcctcgtccgcgatatc
ctcggccgggagccgctgttcgtcgacgccgacgactccgcggacgaggagcgggcgtgg
tcgttcgagccggccccgctcgaggaccccgttctcttcccggctggcgcggccacgtcc
cccgccgatccgcttcccgagccggaatcgtactggtcccttccagatccggagccatac
gcccccgagcgggcgctcgcatccctcgagcgggcggtcgagacggcggccgacgccgcg
ctggggaccgaccacgatatcgcggtcgccttctccggcggggtcgactcggcgctggtc
gccgaactgctcgatgcaccgctgtacgtcgtcggcttccccgacagccacgacgtcgaa
gccgcgcggacggccgccgacgcgatgggccgggagctgacggtcgtcgaactcgagccc
gcggacctcgagcgggcggtcccggaagtcgtgcgagcgaccggccggacgaacgcgatg
gacgtccagatcgccctgccgctgtatctggtcggcgaacgcgtcgccgccgacgggttc
gacgcgctcgcggtcggacagggcgcggacgaactgttcggcggctacgagaaggtcgtc
cggctcgatcaccgggtcgacgccgagacggtccgcggggccgtccgggaggggatccgg
agcctccccgaccagctcccgcgggacgtcctgacgatcgaagcgacggggctcgagccc
gtcgcgccgcttctccacgacgccgtgatcgaggcggcgcttcggttgcccgacgagcta
ctcgccgacaccgaggaacggaaacgcggcttccgccgggttgcggccgaacacctcccg
gccgaagtcgcccagcgggacaagaaagcggtccagtacggcagcctcgtcgcccgcgaa
ctcgaccgcctcgcccggcaggccggctacaagcgccggatcgacgaccacgtcgacaag
tacgtcgccgcgctgtgttcggacggtccgaccgagcgcgactcctccaccacgtcgtct
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system