KEGG   Natrinema pellirubrum: Natpe_2474Help
Entry
Natpe_2474        CDS       T02425                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
npe  Natrinema pellirubrum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Natpe_2474
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Natpe_2474
Enzymes [BR:npe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Natpe_2474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2409568..2410512)
Genome map
AA seq 314 aa AA seqDB search
MRHDHLITSKQLSRGDIETVLDRAAEIDADPSAVADRHANTLLGLLFFEPSTRTKMSFET
AMKRLGGDVVDMGSVESSSVKKGETLADTVRVIEGYTDALVLRHPKQGAATMASEFVDVP
LLNAGDGAGHHPTQTMLDLYTIRENAGLDDLTIGIMGDLKYGRTVHSLAHALTNFETQQH
FISPESLQLPREVVYDLHQRQDGTGIKEHESLEGVLPSLDVLYVTRIQRERFPDENEYQK
VAGEYQIDAETLEAASDDLTVMHPLPRVDEIAPEIDDTDYAAYFDQAHNGVPVRMALLDL
LLSDDRGIRGETDE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcgccacgatcacctcatcacgagcaaacaactctcgcggggagacatcgagacggta
ctcgaccgcgcggccgagatcgacgccgacccgtcggcggtcgccgatcgccacgcgaac
acgctgctcggattgctctttttcgagccgagtacgcggacgaagatgagcttcgagact
gcgatgaaacggctcggcggcgacgtcgtcgacatgggttcggtcgaatcctcgagcgtg
aagaaaggggagacgctggccgacaccgtccgtgtcatcgagggctataccgacgccttg
gtcctgcgccatcccaagcagggggcggcgacgatggccagcgagttcgtcgacgtcccg
ctgctgaacgcgggcgacggcgcgggtcatcacccgacccagacgatgctcgatctctac
accatccgggaaaacgccggcctggacgacctgacgatcggcatcatgggcgatctcaaa
tacggccggaccgtccactcgttggcccacgcgctgacgaacttcgagacccagcaacac
ttcatcagtccggagagtctgcagttgccccgcgaggtcgtctacgacctccaccagcga
caggacgggacggggatcaaggaacacgagtcgctcgagggggtcttgccctcgctggac
gtcctctacgtgacccggatccagcgcgagcggttccccgacgagaacgagtaccagaag
gtcgccggcgagtaccagatcgacgccgagaccctcgaggccgcaagcgacgacctgacc
gtgatgcatccgctgccgcgggtcgacgagatcgccccggagatcgacgataccgactac
gcggcctacttcgaccaggcacacaacggggtcccggtccgaatggcgctgttggacctg
ttgttgagcgacgaccgtgggattcgaggtgagaccgatgagtaa

DBGET integrated database retrieval system