KEGG   Natrinema pellirubrum: Natpe_2637Help
Entry
Natpe_2637        CDS       T02425                                 

Definition
succinate dehydrogenase, hydrophobic anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
npe  Natrinema pellirubrum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Natpe_2637
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Natpe_2637
   00650 Butanoate metabolism
    Natpe_2637
  Energy metabolism
   00190 Oxidative phosphorylation
    Natpe_2637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2580183..2580548
Genome map
AA seq 121 aa AA seqDB search
MAERYSSFTPGGTGWFLQRVTAAFLVVVLAFHFFLLHFVNHAYEVSFMGTQARMENIGYF
LTMVLFLVTAAFHGVNGVYNALVNQGLEGTQKKVVLAVLTIAGVGLVAQGTYVALTMSGM
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgatactcctcctttacgcccggcggcaccggctggttcctccagcgcgtc
accgccgcgttcctcgtcgtcgttcttgccttccacttcttcctcttgcacttcgtcaac
cacgcgtacgaggtaagcttcatgggcactcaggcccgaatggagaacatcgggtacttc
ctcacgatggtcttgttcctggtgaccgccgccttccacggcgtcaacggcgtctacaac
gccttggtcaatcagggactcgaggggacccagaagaaggtcgtgctggcggtgttgacc
atcgccggcgtcggcctcgtcgcgcagggaacgtacgtcgcactcacgatgtcggggatg
atctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system