KEGG   Natrinema pellirubrum: Natpe_2662Help
Entry
Natpe_2662        CDS       T02425                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
npe  Natrinema pellirubrum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:npe00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Natpe_2662
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Natpe_2662
Enzymes [BR:npe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Natpe_2662
Two-component system [BR:npe02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Natpe_2662
Bacterial motility proteins [BR:npe02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Natpe_2662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2606816..2608021)
Genome map
AA seq 401 aa AA seqDB search
MTRVLVVDDSKFMRTVIGNALEEAGYEVERAEDGATGVERAAAIDPDVVTMDVEMPGMDG
IDAVERIMATNPTPILMLSVHTEEGTTATLDALERGAADFLHKPDGSGSRNIAHLTDEVV
EAVDDLAAAEVSSMALARAAATAHATRTGRAGAGEATTGNAVAGGSTETQVSDRSAVGPD
VPSVGSGSGIDEDAAPVTVDGDTETAPTVVIGASTGGPKLIERLFERLPAALEAKVLVVQ
HMPPGFTERFAERLDARSGYDVSEAADRERLAPGEAAVAPGGVHLEVASNVGDRLRLRLD
DGERVHGVRPSIDVTMESVAARITDPICGVVMTGMGRDGAAGIEAIDAAGGHTIAQDEAT
SPVFGIPCQAIETGCVDTVAPADGIADAIVDAFTTDGENDD
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgagtactcgttgtcgacgactcgaagttcatgcggacagtcatcggcaacgcg
ctcgaggaggccggttacgaggtcgaacgggccgaagacggtgcgaccggcgtcgaacgc
gccgccgcaatcgatccggacgtcgtaacgatggacgtcgagatgcccgggatggacggg
atcgacgccgtcgagcgaatcatggcgacgaatccgacacccattctcatgctcagcgtc
cacacggaggagggaacgacggccacgctcgacgcgttagagcgcggggccgcggacttc
ctccacaagcccgacggctcgggctcgcgcaacatcgcacacctcaccgacgaggtcgtc
gaagccgtcgacgacctcgccgccgcggaggtatcctcgatggcactggctcgagcggcc
gcgacagcccatgcgacccgcactgggcgggccggcgcgggtgaagctacgaccggcaac
gccgtcgccggcgggagtacggagacgcaggtatccgatcgctccgcagtcggccccgac
gtccccagcgtcggttccgggtccgggatcgacgaggacgcagcgccagtgaccgtcgac
ggcgacaccgagaccgccccgacggtcgtcatcggcgcgtcgaccggcggcccgaagctc
atcgaacgactgttcgagcgactcccggccgccctcgaggcgaaagtactggtcgtccag
cacatgccgccggggtttaccgagcggttcgccgaacgactcgacgcacgcagcggctac
gacgtaagcgaggccgcggatcgcgagcgactggcacccggcgaagcggccgtcgctccg
ggcggcgtccacctcgaggtagcgagcaacgtcggcgaccggctccgtctgcgactcgac
gacggcgaacgggtccacggcgtccggccgtcgatcgacgtgacgatggaaagcgtcgcc
gcccggatcaccgacccgatctgtggcgtcgtcatgaccgggatgggccgcgacggcgcg
gccggcatcgaggcgatcgacgctgctggcggtcacacgatcgcacaggacgaggcgacg
agcccggtctttggcatcccctgtcaggcaatcgaaactggctgcgtggacacggtcgcg
cccgccgacggcatcgccgacgcgatcgtcgacgcgttcacgacggacggtgagaacgat
gactga

DBGET integrated database retrieval system