KEGG   Natrinema pellirubrum: Natpe_2712Help
Entry
Natpe_2712        CDS       T02425                                 

Definition
Mg-chelatase subunit ChlI
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
npe  Natrinema pellirubrum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Natpe_2712
Enzymes [BR:npe01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Natpe_2712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2654604..2656844
Genome map
AA seq 746 aa AA seqDB search
MVANAGGKKLSSLPFPAIVGQEELKRVLLSVAANDGLDGALIVGEKGTAKSTAVRALVDL
LPEQRAVADCPYGCSPDDPDLQCADCRDRDPDDLPVETRPVPLVTLPLGATRDRVVGTLS
VEDALAGEADFDPGLLARAHRGILYVDEVNLLDDHLVDVILDAAASGVNTVERDGISVSH
PADFTLIGTMNPEEGDLRPQLRDRFALQASVEGCREIDDRVEIIDRALEADGGESDPRTE
YADEVDALREDLTAARDRLSRVDLPTEFKAEIADLCLEAGVDGHRGDVATARTAMTIAAL
EGRETVIESDVHEAATYTLPHRLRSTPFEDEPDLDDLLEDRFDEESPDAEDSDAESDADD
GDGTEGADGEDGDAESEPGDGDEGGDRGEGNGRDGDDNADDEDSSDGAGSDGDEDSADTD
DGPERRPDDGDRPESANQSPAEAGDGGSDDGSSDGESDSEGSPDDGDGDDETAQPLVPGQ
QRAEIGEAAAPDLESPTVDGGETAAATGSRASTSPSTDNRGARVRTEPASGEGSIDAAAS
VRSAAARGGSRVGEDDLRQSVRTGDTSVTIVFAVDASASMRPAMRTAKGVVLELLRDSYE
HRDRVAFVAFAGEDADVLLPPTDSVSLAARHLKDLPSGDRTPLPAGLETSRRVIERAETD
ASVVVLVTDGRANVADGSPTEATRRAARALGDGDTRVVVVDAGDDSRAGLSELVAGETEG
ELVALESLSVETVRAAAERAADETRR
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaaacgccgggggcaaaaagctgtcgtcactcccttttccggcgatcgtcgga
caggaggagttaaagcgcgtactgctttccgtcgcggccaacgacggcctcgacggggcc
ctgatcgtcggcgagaaaggcaccgcgaagtcgaccgccgtccgggcgctcgtcgatctc
ctgccagagcagcgggcggtcgccgactgcccgtacggctgttcgcccgacgaccccgac
ctgcagtgtgccgactgtcgcgaccgcgatccggacgatctaccggtcgaaacccggccc
gtaccgctcgtaacccttccgctcggtgcgacgcgggaccgcgtcgtcggaaccctctcc
gtcgaggacgcgctggcgggcgaggccgacttcgaccccggcctgctggcccgcgctcac
cgggggatcctctacgtcgacgaggtcaatctgctcgacgaccacctcgtggacgtcatt
ctcgatgcggccgccagcggcgtcaacaccgtcgagcgcgacgggatcagtgtctcccac
cccgccgactttaccctgatcgggacgatgaaccccgaagagggcgatctgcgcccgcag
ttgcgggaccgcttcgccctgcaggccagcgtcgagggctgccgggagatcgacgaccgg
gtcgagatcatcgaccgcgcgctcgaggccgacggcggcgagtccgatccgcggaccgag
tacgccgacgaagtcgacgccctgcgtgaggacctgaccgcggcgcgggaccgcctctcg
cgggtcgaccttccgaccgagttcaaggccgagatcgccgacctctgcctcgaggccggc
gtcgacggccaccggggcgacgtggcgacggcccgcaccgcgatgaccatcgcggcgctc
gagggccgcgagacggtcattgagtccgacgtccacgaggccgcgacctacacgcttccc
caccgactccggagtacgcccttcgaggacgaacccgacctcgacgatctgctcgaggac
cggttcgacgaggagtcgccggacgcggaagacagcgacgccgagagcgacgcggacgac
ggtgacggcacggaaggggcggacggcgaggacggcgacgccgagtccgaacccggcgac
ggagacgaaggcggtgatcgcggcgagggaaacgggcgcgacggggacgacaacgcggat
gatgaggactcgagcgacggcgcaggttccgacggggacgaggacagcgccgacactgac
gacggccccgaacgtcgccccgacgacggtgaccgacccgaatcggcgaaccagtcgccc
gccgaagccggcgacggcgggtccgacgacggctcgagcgacggggagtcggactcggag
gggtcgccggacgacggggacggagacgacgagaccgcccagccgctcgtccccggccag
cagcgggccgaaatcggcgaggcggccgcgcccgacctcgagtcgccgaccgtcgacggc
ggcgagacggcggccgcgacggggtcgcgtgcgagtacgtcgccgagtacggacaaccgg
ggcgctcgcgtccgcaccgaacccgcctcgggcgagggctcgatcgacgccgcggcgtcg
gtccggtcggctgccgcccgtggggggtcccgcgtcggcgaggacgacctccggcagtcg
gtccggaccggcgacacctcggtgacgatcgtcttcgccgtcgacgccagcgcctcgatg
cggcccgcgatgcgcactgcgaaaggcgtcgtcctcgagctgttgcgggacagctacgaa
caccgcgatcgggtcgcgttcgtcgccttcgccggcgaggacgccgacgtcttgctcccg
ccgaccgacagcgtctcgctggccgcccgccacctcaaggacctcccctccggcgaccgg
acgccgttgccggccggcctcgagacctcgcgccgagtcatagaacgggccgagactgat
gcttcagtggtcgtcctcgtcacggacggccgggcgaacgtcgccgacgggagcccgacg
gaggcgacgcggcgagccgctcgagccctcggcgacggtgacacccgcgtggtcgtcgtc
gacgcaggggacgactcccgggccggcctctcggaactggtcgccggcgagaccgagggt
gaactggtcgccctcgagtcgctgtcggtcgagacggtccgggctgccgcggagcgggcg
gccgacgagacgcggcgatag

DBGET integrated database retrieval system