KEGG   Natrinema pellirubrum: Natpe_2846Help
Entry
Natpe_2846        CDS       T02425                                 

Definition
(GenBank) peptidase family protein
Organism
npe  Natrinema pellirubrum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2783328..2784386)
Genome map
AA seq 352 aa AA seqDB search
MEQQRRQFLDELLTTATPSGFETPGQRRWVEYVEEFADEVRTDSYGNAVAVLEGNETSIA
LTGHSDEIGFMVRDIEESGILRITPVGGSDRTVSKGQHVRIHTDAGPVSGVIGQTAIHLR
DHEDESVADIDEQYLDIGADDAAEAEELVERGDPVTFDQTVSELENGRIAARGLDNRIGI
WAAAEALRRAAERDHEATIYAVSTVQEEVGLQGAKMVGFDLAPDAVVAIDVTHATDTPDI
TSAQQTGVELGDGPVVVRGSANHPRLVDAVRQTASEADIDIQLQASGTNTGTDADAFYTS
RGGIPSVNVGVPNRYMHTPVEVVDLADLETVAELLSGVPATVADCDLSAGIE
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggagcaacaacgccgtcagtttctcgacgaattactcaccacagcgacgccgtcgggg
ttcgagaccccgggtcaacgtcgctgggtggagtacgtcgaggagtttgccgacgaggtg
agaaccgacagttacggcaacgccgtcgccgtgctggaagggaacgagacgtcgatcgcc
ctcactggacacagcgacgaaatcggcttcatggtgcgggatatcgaagaaagcggcatc
ctccgaataactcctgtcggggggtcggaccggaccgtctcgaagggccagcacgtccgt
attcataccgatgctgggccagtttcgggagtgatcggtcagacggcgattcatcttcgt
gatcacgaagacgaatcggtcgccgatatcgacgagcagtatctcgatatcggcgctgac
gatgcggccgaagccgaggaattagtcgaacgcggcgatccggttacgttcgatcaaacg
gtctccgaactggagaacggacggatcgcagcccgtggattggacaatcgtatcggtatc
tgggctgcggcggaagcacttcggcgggcagccgaacgtgaccacgaggcaacgatctat
gccgtctctacggttcaagaggaggtcgggttacagggcgcgaaaatggtcggcttcgat
cttgcacccgatgcagtagtcgcgatagacgtaactcacgcgacggatactccggatatc
acgtcagcgcaacaaaccggtgtcgaactcggtgatggcccagtcgtcgtacgcggaagc
gcgaaccatccgcgactcgtcgatgcggttcggcagaccgcctccgaggccgatatcgat
attcagctacaggcatcgggaacgaacaccgggacggatgccgatgcgttctatacttcg
cgcggggggattccatcggtgaacgtcggcgtcccgaaccgctatatgcacacacccgtc
gaggtcgtggacctggcggatctcgagacggttgccgaacttctgagtggcgtcccagct
actgttgctgactgcgatctttccgctggcatcgaatag

DBGET integrated database retrieval system