KEGG   Natrinema pellirubrum: Natpe_2846Help
Entry
Natpe_2846        CDS       T02425                                 

Definition
peptidase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
npe  Natrinema pellirubrum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Natpe_2846
Enzymes [BR:npe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Natpe_2846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2783328..2784386)
Genome map
AA seq 352 aa AA seqDB search
MEQQRRQFLDELLTTATPSGFETPGQRRWVEYVEEFADEVRTDSYGNAVAVLEGNETSIA
LTGHSDEIGFMVRDIEESGILRITPVGGSDRTVSKGQHVRIHTDAGPVSGVIGQTAIHLR
DHEDESVADIDEQYLDIGADDAAEAEELVERGDPVTFDQTVSELENGRIAARGLDNRIGI
WAAAEALRRAAERDHEATIYAVSTVQEEVGLQGAKMVGFDLAPDAVVAIDVTHATDTPDI
TSAQQTGVELGDGPVVVRGSANHPRLVDAVRQTASEADIDIQLQASGTNTGTDADAFYTS
RGGIPSVNVGVPNRYMHTPVEVVDLADLETVAELLSGVPATVADCDLSAGIE
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggagcaacaacgccgtcagtttctcgacgaattactcaccacagcgacgccgtcgggg
ttcgagaccccgggtcaacgtcgctgggtggagtacgtcgaggagtttgccgacgaggtg
agaaccgacagttacggcaacgccgtcgccgtgctggaagggaacgagacgtcgatcgcc
ctcactggacacagcgacgaaatcggcttcatggtgcgggatatcgaagaaagcggcatc
ctccgaataactcctgtcggggggtcggaccggaccgtctcgaagggccagcacgtccgt
attcataccgatgctgggccagtttcgggagtgatcggtcagacggcgattcatcttcgt
gatcacgaagacgaatcggtcgccgatatcgacgagcagtatctcgatatcggcgctgac
gatgcggccgaagccgaggaattagtcgaacgcggcgatccggttacgttcgatcaaacg
gtctccgaactggagaacggacggatcgcagcccgtggattggacaatcgtatcggtatc
tgggctgcggcggaagcacttcggcgggcagccgaacgtgaccacgaggcaacgatctat
gccgtctctacggttcaagaggaggtcgggttacagggcgcgaaaatggtcggcttcgat
cttgcacccgatgcagtagtcgcgatagacgtaactcacgcgacggatactccggatatc
acgtcagcgcaacaaaccggtgtcgaactcggtgatggcccagtcgtcgtacgcggaagc
gcgaaccatccgcgactcgtcgatgcggttcggcagaccgcctccgaggccgatatcgat
attcagctacaggcatcgggaacgaacaccgggacggatgccgatgcgttctatacttcg
cgcggggggattccatcggtgaacgtcggcgtcccgaaccgctatatgcacacacccgtc
gaggtcgtggacctggcggatctcgagacggttgccgaacttctgagtggcgtcccagct
actgttgctgactgcgatctttccgctggcatcgaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system