KEGG   Natrinema pellirubrum: Natpe_3294Help
Entry
Natpe_3294        CDS       T02425                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
npe  Natrinema pellirubrum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Natpe_3294
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Natpe_3294
Enzymes [BR:npe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Natpe_3294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3221608..3222450
Genome map
AA seq 280 aa AA seqDB search
MDSDTELAPAVRSILEAARGRSGGEGVVDVDARSLPDALAAAEADGRVPVIAEVKPTSPT
AEGTRADDPVELAQAMVAGGAAAISVLTEPTHFDGSPEALTRVREAVDVPVLRKDFVLEE
DGMDVVEADLLLLIARFVDDLEGLVAAARERGFQPLVEVHDRAELERAIDAGAEIVGVNN
RDLARLEVELETFESVAPHARRVTGLENANGDGVSDVPDDVTLIAESGISSPADVRRMRE
AGADALLVGSAIMDHGTGDSDVTENTRRLTRAESTAGDST
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggactccgataccgaactcgccccggcagtccgatcgatcctcgaggccgctcggggc
cggtcgggcggggagggcgtcgtcgacgtcgatgcgcgctcgctgcccgacgcgctggcg
gcggccgaggccgacgggcgggtcccagtgatcgcggaggtgaaaccgacgagtccgacc
gccgaggggacccgcgccgacgacccggtcgaactcgcgcaggcgatggtcgcgggcggc
gcggcggcgatctcggtcctcacggagccgacccacttcgacggctcgcccgaggcgctg
acccgggtccgcgaggccgtcgacgtccccgtgttgcgcaaggacttcgtcctcgaggaa
gacgggatggacgtcgtcgaagccgacctgctcttgctgatcgcgcggttcgtcgacgac
ctcgagggtctggtcgctgcggcccgcgagcgggggttccagccgctcgtggaagtccac
gaccgggcggaactcgagcgggccatcgatgcgggcgcggagatcgtcggcgtgaacaac
cgggatctggcgcggctcgaggtggaactggaaaccttcgagtcggtcgcaccccatgcg
agacgcgtgacgggtctcgagaacgcgaacggcgacggcgtgagcgacgtaccggacgac
gtgacgctgatcgccgagagcgggatttcgtcgccggccgacgtgcggcggatgcgcgag
gcaggtgccgacgccctgttggtcggcagcgcgatcatggaccacgggacgggcgacagc
gacgtgaccgagaacacgcggcggctcacgcgggcggaatcgacagcgggagactccaca
tga

DBGET integrated database retrieval system