KEGG   Natrinema pellirubrum: Natpe_3489Help
Entry
Natpe_3489        CDS       T02425                                 

Definition
sugar kinase, ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
npe  Natrinema pellirubrum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Natpe_3489
Enzymes [BR:npe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Natpe_3489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3391449..3392333)
Genome map
AA seq 294 aa AA seqDB search
MDSITVLAAGHVNWDVTLRVDRLPESDGEAAIRSQRQSGGGSAANVAAALAGLGVDVGLI
GSVGDDDNGLLARRELEAAGVSLAGVRVVEDAETAVKYLLVDDDGEVAILGNDGVNEAVG
PSALEPSRIRAADHIHLTGQRPETAAAIARIADEAGIGISFDPGRRLADREYGEPLALAD
VVFVTDREAAALFDDDPDGAADDRIVVVTCGADGAEAYAPSGTVVHAGFDIDPVDTAGAG
DAFAAGFLTRWLADRDLERALATGNACGAVTASREGARSAPTDAELEGLLERRP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggattcgatcaccgtactcgcggccggccacgtcaactgggacgtgaccctccgtgtc
gacagactgcccgagagcgacggcgaggcggcgatccgctcgcaacgccagtcgggcggc
ggcagtgcggccaacgtcgccgcggcgcttgccggcctcggcgtcgacgtcggcctgatc
ggcagcgtcggcgacgacgacaacggcctgctcgcccgccgcgaactcgaggccgccggc
gtctctctcgcgggggtccgcgtcgtcgaggacgccgaaacggcggtgaagtacctgctg
gtcgacgacgacggcgaagtcgcgatcctcggcaacgacggcgtcaacgaggccgtcggg
ccgtcggccctcgagccgtcgcggatccgggcggccgatcacatccatctcacgggacag
cgaccggagacggccgccgcgatcgcacggatcgccgacgaggccggtatcgggatcagc
ttcgatcccggtcggcggctcgccgaccgcgagtacggcgaaccgctcgcgctggctgac
gtcgtcttcgtgaccgaccgggaggccgccgccctgttcgacgacgaccccgacggggcc
gccgacgaccggatcgtcgtcgtcacctgcggagccgacggcgcggaagcgtacgcgccg
tcgggaaccgtcgttcacgcggggttcgacatcgaccccgtcgataccgccggtgcgggc
gatgccttcgccgccggctttctcacgaggtggctcgcggaccgcgacctcgagcgggcg
cttgcgaccggcaacgcctgcggggccgtgaccgcgagccgcgagggggcccggagcgca
ccgaccgacgcggaactcgaggggctcctcgagcgccgcccgtaa

DBGET integrated database retrieval system