KEGG   Natrinema pellirubrum: Natpe_3635Help
Entry
Natpe_3635        CDS       T02425                                 

Definition
protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
npe  Natrinema pellirubrum
Brite
Enzymes [BR:npe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Natpe_3635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3553950..3554720)
Genome map
AA seq 256 aa AA seqDB search
MDPAVLREDMVDGLESPPRDVLSDEDVAVAMRDVPRHAFVDDERTAYADRDHEALGTRVL
APSTVARLLQALSLESDQTVLIVGAGVGYTAAVTAEIVGETNVHAVDISRPLVVAARGNL
AEAGYEGVLVDRRDGADGLPEYAPFDRILLEAAAVDPPRALLSQLTDRGRLVFPRGTQRQ
RLEAVSSDGAVDRFDPVSFDPLLVEGEQSGAVERNRTTREDRERAQRRAESRRGWEHDWI
EWEDAGDGQSRRQSPR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggatcccgcggtactgcgcgaggacatggtcgacggcctcgagtccccgcctagggac
gtactgagcgatgaggacgtggccgtcgcgatgcgcgacgtcccgcgtcacgccttcgtc
gacgacgagcggacggcctacgccgaccgcgaccacgaggcgttggggacgcgcgtcctc
gcccccagcaccgtcgcccgcctgctgcaagcgctgtcgctcgagtccgaccagacggtg
ttgatcgtcggtgccggcgtcggctacaccgccgccgtgacggccgagatcgtcggcgag
acgaacgtccacgccgtcgacatctcccgcccgttagtcgtcgcggctcgaggcaacctc
gccgaagcgggttacgagggcgtcctcgtcgaccgccgcgacggcgcggacggcctcccc
gagtacgcacccttcgaccgcatcctgctcgaagcggccgcggtcgatccgccgcgcgcg
ctgctctcgcagttgaccgaccgcggccggctcgtcttcccccgtggcactcagcgccag
cgtctcgaggctgtctcgagcgacggcgcggtcgaccggttcgacccggtttcgttcgac
ccgcttctcgttgagggcgagcagtccggcgcggtcgagcgcaatcggacgactcgcgag
gaccgcgagcgcgcccaacgacgcgccgagtcccgccggggctgggaacacgactggatc
gagtgggaggacgcgggcgacgggcagtcccgacgacaatcgccacgataa

DBGET integrated database retrieval system