KEGG   Natrinema pellirubrum: Natpe_3677Help
Entry
Natpe_3677        CDS       T02425                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
npe  Natrinema pellirubrum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Natpe_3677
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Natpe_3677
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Natpe_3677
Enzymes [BR:npe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Natpe_3677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3598543..3599820)
Genome map
AA seq 425 aa AA seqDB search
MSLSLSAEQPDQPADADEGVWLECIECGETFAPFDDVRYTCDDCDGLLEVRYAELPTFDD
FEGEGVWRYADALPFEAGVSIQEGATPLYEVPRLEDEIGIEALRIKHEGMNPTGSFKDRG
MTVGVKVAKELGVGRLACASTGNTSAALAAYGSRGGMQTLVLLPAGKVAAGKIAQASLHG
ARILEVDGNFDACLDIVQELAGQGEAYLLNSLNPFRLEGQKTIGLEILEGFLADYDAVPD
RIVLPVGNAGNTSALYKAFRELVQAGALDEDDVPKLTGVQAEGAAPMVEAVENGADEVRR
WEDVETRATAIRIGNPVNAPKALPGIRETDGTAVAVSDEEITEAQRDIAAEGIGVEPASA
ASVAGLRKLRAEGIVDDDERVACLTTGHLLKDPDAAAAAGSEPKSVPADTEGVLASLASE
GSSDR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcagtctctcggccgagcaacccgaccagcctgccgacgccgacgagggcgtt
tggctcgagtgcatcgagtgcggcgaaaccttcgctccgttcgacgacgtccgctacacc
tgcgacgactgcgatggcctcctcgaggtccgctacgccgagctgccgacgttcgacgac
ttcgagggcgagggtgtctggcgctatgccgatgccctgccgttcgaggccggcgtctcg
attcaggaaggggcgaccccgctgtacgaggtcccccgtctcgaggacgagatcgggatc
gaagcgctgcggatcaaacacgaggggatgaacccgacggggtcgttcaaggaccgcggc
atgaccgtcggcgtcaaggtcgcaaaagaactcggcgtcggccgactggcctgtgcttcg
acgggcaacaccagcgccgccctggccgcctacggctcccgtggcggaatgcagacgctc
gtcctcttgcccgcgggcaaggtcgccgccggcaagatcgcacaggccagcctccacgga
gcccgcattctcgaggtcgacggcaacttcgacgcctgtctcgacatcgtccaggaactc
gcggggcagggcgaggcctacctgctgaactcgctgaaccccttccggctcgaagggcag
aagacgatcggcctcgagattctcgagggctttctcgccgactacgacgccgtcccggac
cgaatcgtgctgccggtcggcaacgccggcaacacgtcggcgctgtacaaggccttccgc
gaactcgtccaggccggcgcactcgacgaggacgacgtcccgaaactgaccggcgtgcag
gccgagggggccgcgccgatggtcgaagcggtcgagaacggggccgacgaagtacggcgc
tgggaggacgtcgagacccgcgcgaccgcgatccggatcgggaacccggtcaacgcgccg
aaggcactgcccggtatccgggagaccgacggaaccgccgtcgcggtctccgacgaggag
atcaccgaggcccaacgggacatcgctgccgaggggatcggcgtcgaaccggcctccgca
gcctccgtcgccggcctgcgaaaactccgagccgaggggatcgtcgacgacgacgaacgc
gtcgcctgtctgaccaccggccacctgctcaaagatcccgacgctgccgctgcggcgggg
agcgaacccaaatccgtgccggccgacactgaaggagtcctcgcgagtcttgcgagtgag
ggctcgtcggatcgatag

DBGET integrated database retrieval system