KEGG   Natrinema pellirubrum: Natpe_3794Help
Entry
Natpe_3794        CDS       T02425                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
npe  Natrinema pellirubrum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Natpe_3794
Enzymes [BR:npe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Natpe_3794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3707666..3708406
Genome map
AA seq 246 aa AA seqDB search
MTNTPTVAVFRPDDDRIERATDLLAELGAEPVPDPMLAVEATDAVPRTDADYVVFTSKTG
AELIAAAGWEPTGETVCAIGPATADALRAEGYTVDLVPEEFTSSGLVAALSDAVDGARVE
VARSDHGSPVLLDGLEEAGAYVHETILYRLVRPEGSGESARLAAAGDLDAACFTSSLTVD
HFLEAAAEAGVRDATIAGLEDAVVGVIGEPTAETAAERGVDVDLVASEATFERLAAETVD
AATDGE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgactaatacccctaccgtcgccgtctttcggcccgacgacgaccgcatcgagcgggcg
accgacctgctcgcggaactgggtgccgagccggtcccggacccgatgctcgcggtcgag
gcgaccgacgccgtcccgcggaccgatgcggactacgtcgtcttcacgagcaagaccggc
gcggaactgatcgccgcggccggctgggagccgaccggcgaaaccgtctgtgccatcggg
ccagcgacggccgacgcgctccgcgcggagggatacacggtcgatctcgttcccgaggag
ttcacctcgagcgggctggtcgcagcgctttcggacgccgtcgacggcgcacgcgtcgag
gtcgcccgcagcgaccacggcagcccagtgttgctcgacgggctcgaggaggcgggcgcg
tacgtccacgagacgatcctctaccggctggtccggcccgagggaagcggcgagtccgcc
cggctggccgccgccggcgacctcgacgccgcctgtttcacctcgtcgctgaccgtcgac
cacttcctcgaggccgccgcggaagcgggagttcgggacgcaaccatcgcgggactcgag
gacgccgtcgtcggcgtcatcggcgagccgacggccgagaccgccgccgagcggggcgtc
gatgtcgatctggtcgcgagcgaagcgaccttcgaacggctggccgcggagaccgtcgac
gcggcgaccgacggcgaatga

DBGET integrated database retrieval system