KEGG   Natrinema pellirubrum: Natpe_4364Help
Entry
Natpe_4364        CDS       T02425                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
npe  Natrinema pellirubrum
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:npe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Natpe_4364
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Natpe_4364
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Natpe_4364
   00680 Methane metabolism
    Natpe_4364
Enzymes [BR:npe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Natpe_4364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNATPE02:156137..158830
Genome map
AA seq 897 aa AA seqDB search
MELHGRSVRQDVRELGETLGDVIAGHASDISFEAVETARTAAIDYRSGDAPDRRPLERSL
RQNPEDVNTDIARAFTNYFELINLAEERERIRALRRGEHEGSLGDSLRAAVETLANEGAP
PETVARVLEDVRVKPTFTAHPTEARRKTVKASLQRVSDLIKELDERRLTDQERKVKLERL
DALVESLWTTRQVRERRPEPFDESRNVHWYLANVIFDVVPQVYEELEDALEAEYDDPPEV
PQILDFRSWAGSDRDGNPYVTPEVTEKTLGRQRRLVLERYQEALADIAGVLSQDATRVDV
NGLPESLQTDAHAVPGVVERANERYPDEPFRQKVAVMLERVSRVDDVRPGGYEDSAAFHG
ELERLTEALRNTSLDDVATEYVDPLIRQVETFGFHLAALDLRDHQQMHTGALEQALSQKN
IDYTGMNEGERVEFLTEAILQDQPVLDLTDTEGLDDDASRVFRRFDALENWQREYGPEAI
DMYAISMTEEPSHVLEVLFLADQAGVTCLPDHAGIDIVPLLETESALSGARRIMGTLFEN
DAYTQSLQARDGVQEVMLGYSDSNKENGFLAANWEFDRAQRRLAQITDDYGVGLRFFHGR
GGSISRGGGPMNEALLALPKETVSGEVKFTQQGEAIAETYGNPRIAERELEQMLNAQVRS
RHAAVTQPDDRLPGHWEDAMDIMAEAARDAYRDLLETEGFVSYFEQATPITVIEQLNLGS
RPASRSGERSVEDLRAIPWVFSWTQSRCIIPGWYGLGTGIQTYLDKGGDLQVLREMYEGW
PVFQTTLDNAALSLARTEMEIASEYANLAEDDLREEFFPRIQAEYENASGHVLATTQRDD
LVDRPWLRESLNRRNPYVDPLNYLQIDLLNQSHRTNQAERTLRLTVKGIAAGMKNTG
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggagttacatggtcggagcgtgcggcaggacgtccgcgaactcggtgagactctcggg
gatgtcatcgccggccacgcatcggatatctcgttcgaagccgtcgaaacagcccgtacc
gccgccatcgactatcgtagcggtgacgcaccggaccgacgaccactcgagcgatcactc
agacagaacccagaagacgtcaacacggacattgcccgcgcgttcacgaactacttcgaa
ctcatcaatctcgccgaagaacgcgaacgcatccgagccctgcgccgcggcgaacacgag
gggagccttggggacagtctccgcgcagccgtcgaaaccctcgccaacgagggcgcacca
cccgaaaccgtcgcccgcgtcctggaggacgttcgcgtcaaaccgaccttcaccgcgcat
cccaccgaggcacgtcgcaagaccgtgaaggcctccctccagcgcgtcagcgacctcatc
aaggaactcgacgaacgtcgcctcaccgaccaagaacgcaaagtcaaactcgagcgcctc
gacgccctcgtcgagagcctgtggacgacccgccaagtccgcgaacgacggccggaaccg
tttgatgaatcccgaaatgtccactggtatctcgctaacgtcatcttcgacgtcgttccc
caggtctacgaggaactcgaagacgcactcgaggccgagtacgacgatccacccgaggtt
ccccagatccttgacttccgatcctgggctggcagcgaccgcgatggcaacccctacgtc
actcccgaagtcaccgagaagaccctcggccgccagcgccgactcgtccttgagcgctat
caggaggccctcgccgacatcgccggcgtcctcagccaggacgccacccgcgttgatgtc
aacggcctccccgaatccctccaaaccgacgcccatgctgtccccggcgtcgtcgaacgc
gcgaacgaacgctaccccgacgaacccttccgccagaaggtcgccgtcatgctcgaacgc
gtctcccgcgtcgacgacgtccgacccggaggctacgaggattcggcggccttccacggc
gaactcgaacgcctcaccgaggcactccggaacaccagcctcgacgacgtcgccacggag
tacgtcgacccactcattcggcaggtcgagacctttggcttccacctcgccgccctcgac
ctccgcgaccaccagcagatgcacaccggcgccctcgaacaggccctctctcagaagaac
atcgactacaccgggatgaacgagggtgagcgcgtggagttcctcacggaggccatcctc
caggaccaacccgtcctcgacctcaccgataccgaggggctcgacgacgacgcgagccgc
gtatttcgccgctttgacgccctcgagaactggcagcgcgagtacggccccgaggccatt
gacatgtacgccatcagcatgaccgaggaacccagccacgtcctcgaagtccttttcctc
gccgaccaggctggcgtcacctgcctccccgaccacgccggtatcgacatcgtccccctc
cttgagaccgaatccgcactctccggcgcccgccgcatcatgggcacacttttcgagaac
gacgcctatacccagagcctccaagcccgcgacggcgtccaagaggtcatgctcggatac
tcggactccaacaaggagaacggcttcctcgccgcgaactgggagttcgaccgcgcccag
cgtcgcctcgcccagatcaccgacgactatggggttggtctccgcttcttccacggccgc
ggcggctccatctcccgtggtggcggccccatgaacgaagccctccttgccctccccaaa
gagaccgtctccggcgaggtcaagttcacccaacagggcgaagccatcgccgaaacatat
gggaatccgcgcatcgctgagcgcgaactcgaacagatgctcaacgcccaggtccgctcc
cggcacgccgctgtcacccagccagatgaccgtctccctggccactgggaggacgccatg
gacatcatggccgaagccgcccgcgatgcctaccgcgacctcctcgaaaccgagggattc
gtctcctacttcgagcaagccaccccaatcaccgtcatcgaacagctcaacctcggctcc
cgccccgcctcccgaagcggagagcgcagcgttgaggacctccgcgctatcccctgggtg
ttttcctggacccagtcccgctgcatcattcccggctggtatggcctcggcactggcatc
cagacctacctcgacaaaggcggcgacctccaagtactccgcgagatgtacgaggggtgg
cctgtcttccagactaccctcgacaacgccgcgctcagccttgcccgcaccgagatggag
atcgccagcgagtacgctaacctcgctgaagacgacctccgcgaggaattcttcccacgc
atccaggccgagtacgagaatgcgagcggccacgtcctcgccaccacccagcgcgacgac
ctcgtcgaccgcccgtggctccgagagagcctcaaccgccgcaatccctatgttgaccca
ctcaactacctccagattgaccttctcaaccaaagccaccgtaccaatcaggcagaacgc
acactccgcctgacggtcaaaggaatcgccgccggcatgaagaacaccggctga

DBGET integrated database retrieval system