KEGG   Natronomonas pharaonis: NP0018AHelp
Entry
NP0018A           CDS       T00279                                 

Gene name
pimT_1
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nph  Natronomonas pharaonis
Brite
Enzymes [BR:nph01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NP0018A (pimT_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8106..8744
Genome map
AA seq 212 aa AA seqDB search
MSEESFAAQRDRMVDALAESGRIEREATLEALRAVPRHEFVPEPRREEAYADRPLPIGDG
QTVSAPHMVGIMCDRLGLAAGDDVLEIGTGCGYHAAVTAEIVGDDNVYSVEYIERLAEAA
RERLDTLGYGGVSVRVGDGHEGWPEHAPYDAVYLTCATPAIPDPLVEQLRVGGRLLAPVG
DTTQRLIEATKTDDGLERTQHGAVRFVRMQGD
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggagtcgttcgcggcacagcgcgaccgaatggtcgatgccctcgccgagagc
ggccgcatcgagcgcgaagcgacgctcgaagcgctgcgtgcggtcccccgacacgagttc
gttcccgagccgaggcgtgaggaagcctacgccgaccggccactccccatcggcgacggg
caaaccgtctccgcgccacacatggtcggcatcatgtgtgaccgcctcgggctggccgcc
ggcgacgacgtgctcgaaatcgggacgggctgtggctaccacgcggctgtcacagccgaa
atcgtcggcgacgacaacgtctacagtgtcgagtacatcgagcggctcgccgaggcggcc
cgcgagcggctggacacgctcggctacggcggcgtttcggtccgtgtcggcgacggccac
gagggctggcccgaacacgcgccctacgacgcggtgtatctgacctgtgcgaccccggcg
attccggacccgctcgtcgaacagctccgggtcggcggccggctgctcgcccccgtcggc
gatacgacccaacggctcattgaggccacaaagaccgacgacgggctcgaacggacacag
cacggcgctgtcaggttcgtccggatgcagggcgactag

DBGET integrated database retrieval system