KEGG   Natronomonas pharaonis: NP0020AHelp
Entry
NP0020A           CDS       T00279                                 

Gene name
pimT_2
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nph  Natronomonas pharaonis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8784..9524
Genome map
AA seq 246 aa AA seqDB search
MDPAVLRDDMVDSLEHEAKAVVRSERVSVAMRAVPREPFVEDESLAYADRTGEQLGTRVL
SPSAAGRLLEALDVEPDDSVLVVGAGVGYTAAVLAALTDETEVHAVDIDRRLVAAARSNL
ATAGYPGVLVDCRDGADGLPEYAPYDRILVEAAVVEPPRALLGQLADGGRLVAPLGNGAQ
ELVAIEGGERVAEYGTVAFRPLLVDGERADTVERNRTRREDREHAQRAAERRRGWEQSWI
DWDRHR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgcggtactcagagacgacatggtcgacagcctcgaacacgaggcgaaggct
gtcgtccgctccgagcgcgtcagcgtcgcgatgcgggcggtcccccgagagccgttcgtc
gaagacgaatcgctcgcctacgccgaccggaccggcgagcaactggggacgcgggtactc
tcgccgagcgccgccgggcggctgctcgaggcgctcgacgtcgagccggacgattcggtg
ctggttgtcggggctggtgtcggctacacagcggcggtgttggcggcgctgaccgacgaa
accgaagtccacgccgtcgacatcgaccgccggctcgtcgctgcggcgcggtcgaacctc
gctaccgcgggctatcccggcgtgttggtcgactgccgagacggggcggacggattaccc
gaatacgctccgtacgaccggattctcgtcgaggcggccgtcgttgagccgccgcgggcg
ctgcttggccagcttgccgacggtgggcgactggtcgccccgctcggcaacggggcacag
gaactcgtcgccatcgagggcggcgagcgtgtcgccgaatacgggaccgtcgcgttccgg
ccgctgctcgtcgacggcgagcgggcagacaccgtcgagcggaatcggacccgtcgcgaa
gaccgcgagcacgcccagcgagccgccgagcgccggcggggctgggagcagtcctggata
gactgggaccgccaccggtag

DBGET integrated database retrieval system