KEGG   Natronomonas pharaonis: NP1094AHelp
Entry
NP1094A           CDS       T00279                                 

Gene name
chlID
Definition
magnesium chelatase (protoporphyrin IX magnesium-chelatase), fused subunits ChlI/ChlD (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
nph  Natronomonas pharaonis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nph00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
537347..539473
Genome map
AA seq 708 aa AA seqDB search
MIDNGDGKSVSTPFGAVVGQERLKRALLTVATDDGLGGLLVAGEKGTAKSTLVRGLADLL
PDQRVIADCPYRCPPDDPDSQCADCRERTDPPVETRPVPLVTLPLGATRERVVGTLSVSD
ALSGEANFEPGLLARANRGILYVDEVNLLDDHLVDVLLDAAASGENRVERDGVSVTHPAA
FTLVGTMNPEEGDLRPQLRDRFALSVEVAGETDIEDRVAIIDGALGKAEPDDDTDSYRKR
LQAARSLLPSVELTDEQKRDIADLCLDAGVDGHRADIATARAARALAALDGRPTVTDGDL
QQAAAFALAHRMRSTPFEDAPDADSVIDDHFEDGNEAESGDEKTDDGETDAEGGADADSG
GEAGSDGDGDAATDEDASAEPDSDGESGSEDGPGSEDTTDPSGGDGGDSSRQPAEGDADP
SDDGGQGDASDDPKPSDDADEEATPLVPGQNRQAPGAADAPDVESPAVDTAGDTGSGSAR
TQRGDRGARVRTEPADTDDSAVDAAASVRAAAKHGRNRPTDRDLRRSVRAGDSEALVVFA
VDASASMRPAMRSAKGVVLELLEGAYTERDSVAVVAFAGDDAEVLLPPTDSVTLAARHLK
DLPTGDRTPLPAGLRTAAEVVDRADPDAAVVVVVSDGRANAADSPTADTEAAAAALAETD
ARVVCVDAGDEDSRGLLPAVADRTAGRLVPLAELTPERVDDELGRVSR
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
gtgattgacaacggggacggcaaaagcgtttccacgccgttcggcgcggtggtcggacag
gagcggctcaagcgggcgctgttgaccgtcgcgaccgacgacgggctgggggggctgttg
gtcgccggcgaaaaggggacggccaagtcgacgctcgtccgcggactcgcggacctgctc
cccgaccagcgtgtcatcgccgattgcccgtaccgctgtccgccggacgaccctgacagc
caatgtgccgactgccgggagcgaacggacccaccggtcgagacccggccggtaccgctc
gtgacgctgccgctgggagcgacccgcgagcgggtcgtcgggacgctttcagtgtcggac
gcgctgtccggcgaggcgaacttcgagccgggactgctcgctcgtgccaaccgcggcatc
ctctatgtcgacgaggtcaaccttctcgatgaccacctcgtcgacgtactgctcgatgcg
gccgcgtccggcgaaaaccgggtcgaacgcgacggcgttagtgtcacccaccccgctgcg
ttcacccttgtcgggacgatgaaccccgaggagggcgacctccggccacagctccgtgac
cgctttgccctctcggtcgaggttgccggcgagaccgacatcgaagaccgggtcgccatc
atcgacggcgcactcggcaaagcggagccggacgacgacaccgacagctaccgaaagcgg
ctacaggcggcccgctcgctgcttccgtcggtcgagttgaccgacgaacaaaagcgggac
atcgccgacctctgtctcgacgccggcgtcgacggccaccgtgccgacatcgcgaccgcc
cgcgccgcccgcgcgcttgcggcccttgacggccggccgacggtcactgacggtgaccta
cagcaggccgcggcgtttgcgcttgcccaccggatgcggtcgaccccgttcgaggacgct
cccgacgccgactccgtcatcgacgaccacttcgaggacggcaacgaggccgaatcgggc
gacgagaagacggatgacggtgagacagacgctgaaggcggtgccgacgccgacagcggc
ggcgaggcgggttcggacggggacggcgatgctgcgacagatgaagacgcctccgccgag
ccggactcggacggcgaatcgggctccgaagacggccccggcagcgaggacactactgac
ccatcgggcggcgacggaggcgacagctcccgacagccggccgagggcgacgccgacccg
tcggatgacggcggccaaggggacgcttcggacgacccaaagccgtcagatgacgccgac
gaggaggcgacgccgctcgtccccggccaaaaccggcaggcacccggagccgccgatgcg
ccggacgtcgaatcgccggccgttgacacggcaggcgacacgggtagcggctcggcacgg
acccagcgcggcgaccgaggcgcacgcgtcagaacggagccggccgacacagacgacagt
gccgttgatgccgcggcatcggtccgcgccgccgcaaagcacggccggaaccggccgacg
gaccgcgacctccgacggtcggtccgggcgggcgacagcgaggcgctcgtcgtcttcgcc
gttgatgccagcgcctcgatgcggccggcgatgcgctctgcgaagggcgtcgttctcgag
ctgctggagggggcctacaccgaacgcgacagcgtcgcagtcgtcgcgtttgccggcgac
gacgccgaggtgctcttgccgccgacggattcggtgacgcttgcggccagacatctcaag
gacctcccgaccggcgaccggacaccgctccccgcagggctccggacggctgccgaagtc
gtcgaccgggctgaccccgatgccgccgtcgtggtggtcgtctccgatggccgcgccaac
gcggccgactcgccgaccgccgacaccgaggccgccgccgctgccctcgccgagacggac
gcgcgggtcgtctgtgttgatgccggcgacgaggacagccgggggttgctcccggcggtg
gccgaccggactgccggccggctcgttccgctcgccgagttgacgccggagcgggtcgac
gacgagcttggccgggtcagccgatag

DBGET integrated database retrieval system