KEGG   Natronomonas pharaonis: NP1260AHelp
Entry
NP1260A           CDS       T00279                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
nph  Natronomonas pharaonis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nph00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NP1260A (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NP1260A (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    NP1260A (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NP1260A (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NP1260A (adh)
   00626 Naphthalene degradation
    NP1260A (adh)
Enzymes [BR:nph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NP1260A (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
618787..619854
Genome map
AA seq 355 aa AA seqDB search
MRAVVFEEAGEPMEVQEVDRPEADADEIVVETEACGVCRSDWHAWQGDWDWIGVAPTPGL
VFGHEPVGTVKEVGEDVSELSVGDRVCVPFNLSDGTCRYCKQGRANICERVVPMGFVPFQ
PGAFAEEFPVRNADHNAIKIPDGVDPVDVAGLGCRFATAFHGLVHRVDVTPGDWVAVHGC
GGVGLSAIHVADALGANVIGVDLGEDKLDKAVELGADATVNVTEVEDVPQAVKAHTPSSR
GVEVSVDALGVAETCRNSVNSLAKGGQNLQIGLTTSEEEGEVSLPVDNIVMEEREFVGSF
GMPPHEYEEIFSMMAQDKIDPGKIVSETVSLEEVPEVIASMDDYGTVGIPVCDEF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctgtcgtcttcgaggaggcgggcgaaccgatggaagtacaggaggtcgaccga
ccggaggccgacgccgacgaaatcgtcgtcgagaccgaggcctgtggtgtctgccggtcc
gactggcacgcctggcagggcgactgggactggatcggcgtcgcgccgaccccggggctt
gtcttcggccacgagccggtcgggacagtcaaagaagtcggcgaggacgtctcggaactc
agtgtcggcgaccgggtttgtgttccgttcaacctcagcgacggcacctgtcggtactgc
aagcagggccgcgcaaacatctgtgaacgcgttgttccgatgggctttgtccccttccag
ccgggggccttcgccgaagagttcccggtcagaaacgccgaccacaacgccatcaagatt
cccgacggcgtcgacccggtcgatgtcgccggcctcggctgccgatttgcgactgcgttc
cacggcctcgtccaccgcgtcgatgtcacgcccggcgactgggtcgccgtccacggctgc
ggcggtgtcggcctctcggcgattcacgtcgccgatgcgctcggtgcgaacgtcatcggc
gttgacctcggcgaagacaaactcgacaaggccgtcgaactcggagcggacgcgaccgta
aacgtcaccgaagtcgaagatgtcccgcaggccgtcaaggcacacaccccgagcagtcgc
ggtgtcgaggtcagcgtcgacgccctcggtgttgccgagacctgccgcaactcggtgaac
tcgctggcaaagggcggccagaaccttcagatcgggctcacgacgagcgaggaggaaggc
gaggtgtcactacccgtcgacaacatcgtcatggaggaacgcgagttcgtcggctccttc
ggcatgccgcctcacgagtacgaggaaatcttctcgatgatggcacaggacaagatcgac
cccgggaaaatcgtctccgagacggtctcgctggaggaggttccggaggtcatcgcctcg
atggacgactacggaacggtcggtatcccggtctgcgacgagttctga

DBGET integrated database retrieval system