KEGG   Natronomonas pharaonis: NP1432AHelp
Entry
NP1432A           CDS       T00279                                 

Gene name
aor_2
Definition
aldehyde ferredoxin oxidoreductase 2 (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
nph  Natronomonas pharaonis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nph01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:nph00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
690737..692428
Genome map
AA seq 563 aa AA seqDB search
MIHTEGPLLSIDVSDRTASEAAIDDVLESYIGGRGVGTKLAHDRIPFDADPLGPENRLVF
ATGPLQTSIMSYTGRMSCTGLSPLTDGLLSSNAGGFMSRPFADTGYAAVEIAGASDELVG
IHVTDEGVTFESAADLEGATVEETVDHIEAATDLDVEHTAIVGPAGENEVRFASIMTSGS
RAFGRGGLGAVLGSKNVKYLTFDGDSRRPVEGIDEELVMDIHSEASESGSPMKDAGTTSV
SDYANSVGALPTKYFSELSYDKVDQIGSSAVIEHKYKKGTCSSCAFACKLPTRDEETGLE
TEGPEFETMMAFGSNALVDDFVAIMKSNELCDQLGLDTISCGDVIAAYLESEDEFGNVDL
IHDLIEQIAHRDGIGDTLAEGIDRVHDELGVENWSMKGMEFAAHDGRTLNGQGLGYATSN
RGADHMYGEFYHHEYPLVPPAEAVDADGVAGKSEKLVELENKNAIHDSGVLCKFASSNLG
PERYARLFDTDWETLQSVGGRIVDLERHFNNQRGFDRADDDDLPYELEGLGEELSAYYDH
RGWNDDGTVPNEHVETSFTPADD
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgattcacacagagggaccgctgctgtctatcgatgtcagtgaccgaacggccagcgaa
gcggccatcgacgacgttctcgaatcgtatatcggcggccgtggcgtcggcacaaagctc
gcacacgaccggataccgttcgacgccgacccgctcggtcccgagaaccgcttggtgttt
gcgaccgggccgctgcagacctcgattatgagctacaccgggcggatgtcctgtaccggg
ctgtcaccgcttactgacggcctgttgtcgtcgaacgccggcggcttcatgtcccgtccg
ttcgccgacaccggctacgcggccgtcgagattgcgggcgcgagcgacgaactcgtcggc
attcacgtcactgacgaaggtgtcaccttcgagtccgctgccgacctcgaaggcgcgacc
gtcgaagagactgtcgaccacatcgaggcggctactgacctcgatgtcgaacacaccgca
atcgtcggtccggccggcgaaaacgaggtccggttcgcatcgattatgacctccggctcg
cgggcgttcggccgcggtggtctcggtgctgtcctcggctcgaagaacgtcaagtacctc
accttcgacggcgactcccgtcgaccggtcgaggggatcgatgaggaactcgtcatggac
atccacagcgaggcctccgagtccggcagcccgatgaaagacgccggcaccacctcggtg
tcagactacgcgaactcggttggagcgctgccgaccaaatacttctccgaactcagctac
gacaaggtcgaccaaatcggctccagcgccgtcatcgagcacaaatacaagaagggcacc
tgttcgtcgtgtgccttcgcctgtaagctcccgacccgcgacgaggagacgggcctagaa
accgaaggccccgagttcgagacgatgatggcgttcggttcgaacgcactggttgacgac
ttcgtcgccatcatgaaatccaacgagctgtgcgaccagctcggcctcgatacgatttcc
tgtggcgatgtcatcgcggcctacctcgaaagcgaagacgagttcggcaacgtcgacctc
atccacgacctcatcgaacagattgctcatcgcgatggcatcggcgacacgcttgctgag
ggtatcgaccgcgtccacgacgaactcggggtcgaaaactggagcatgaagggtatggag
tttgccgcccacgacggtcggacgctgaacgggcaggggctgggctacgctacctcgaat
cgcggcgcggaccacatgtacggagagttctaccaccacgagtatccgctggttccgccg
gcagaggcggtcgacgccgacggcgttgccgggaaatccgagaagctcgttgaactggag
aacaaaaacgccatccacgattccggcgtgctctgtaagttcgcctcctcgaacctcggc
cccgaacggtacgcccggctcttcgatacggactgggagacgctacagtcggttggcggc
cgcatcgtcgacctcgaacgacatttcaacaaccagcgtggctttgaccgtgccgacgac
gacgaccttccgtacgaactcgaagggctcggcgaagagctgtcggcgtactacgaccac
cgcggctggaacgacgacggaaccgtcccgaacgaacacgtcgagacgtcgttcaccccg
gccgacgactaa

DBGET integrated database retrieval system