KEGG   Natronomonas pharaonis: NP2182AHelp
Entry
NP2182A           CDS       T00279                                 

Gene name
tpiA_1
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nph  Natronomonas pharaonis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NP2182A (tpiA_1)
   01230 Biosynthesis of amino acids
    NP2182A (tpiA_1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NP2182A (tpiA_1)
   00051 Fructose and mannose metabolism
    NP2182A (tpiA_1)
   00562 Inositol phosphate metabolism
    NP2182A (tpiA_1)
Enzymes [BR:nph01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NP2182A (tpiA_1)
Exosome [BR:nph04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NP2182A (tpiA_1)
  Exosomal proteins of bladder cancer cells
   NP2182A (tpiA_1)
  Exosomal proteins of melanoma cells
   NP2182A (tpiA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1061358..1062005)
Genome map
AA seq 215 aa AA seqDB search
MFVVVNLKAYPCDPVAVAEAAADVADETGVRIAVAPQAADISRVAETGVETWAQHVDAVD
HGSHTGSTLAEAAAEAGAEGTLLNHSEKRLRLADIDGGLRAAERVGLESIVCANNPRQIA
AAAALEPDAVAVEPPALIGTGTPVSQADPEVVTDSVEAADAVGDVDVLCGAGISTGDDLE
AAAELGAEGVLLASGVAKADAPKAALRDLVEPIAE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcgtagtcaacctgaaagcctatccgtgcgacccggtcgccgtcgccgaggcc
gccgccgatgtcgcagacgagacgggcgttcgcatcgccgtcgcgccacaggccgccgac
atcagccgcgtcgccgaaaccggtgtcgagacgtgggcccagcacgtcgacgccgttgac
cacggctcccataccggttcgacgctcgccgaggccgcggctgaggctggtgccgaggga
acgctgctcaatcactcggaaaaacgcctccgccttgctgacatcgatggcgggctccgg
gccgccgagcgggtcggactggagagtatcgtctgtgcgaacaatccgcgacagatcgcc
gccgcggccgcgctggagccggacgccgtcgctgtcgagccgccggcgctcatcggcacc
ggaaccccggtttcgcaggccgaccccgaagtcgtcaccgactccgtcgaggccgccgac
gcggtcggcgacgtggacgttctctgtggggccggcatctcgaccggcgacgacctcgaa
gctgccgcagaactcggggccgaaggagtgctgttggcctccggcgtcgcgaaggcggat
gccccgaaggcagcgttgcgggacctcgtcgaacccatcgcagaatag

DBGET integrated database retrieval system