KEGG   Natronomonas pharaonis: NP2872AHelp
Entry
NP2872A           CDS       T00279                                 

Definition
protein acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
nph  Natronomonas pharaonis
Brite
Enzymes [BR:nph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NP2872A
Transfer RNA biogenesis [BR:nph03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    NP2872A
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1381485..1383143)
Genome map
AA seq 552 aa AA seqDB search
MSADTDAESEVFERVCESLVEGILDGDIDRDNLESAKMDACREHSSPKVPKNTDLLDYAP
EEQREELESVLQRKPVRTASGVSPVAIMTSPHMCPHGKCLYCPGGPASEFSSSQSYTGHE
PAAARGVQNDYDPYGQVTLRLHQLREIGHPVDKVELILMGGTMTARSHDYQEWFVKRALE
AMNDYDLDSPPAPSEEDSFKPDPEDVDFRYLEDVIAENETANIRNIGTTFETKPDWCDPE
QIDRMLRLGGTKVEVGVQTTYERINREMHRGHGVQASLDANRRLRDAGFKVGFHMMPGQP
GMSKEMCLQDFREIFENADWRPDYLKIYPTLIVRDTVTYDMWRRDEYEPLNNEEAAELVA
EIKSMIPRYTRLQRVQRDIPADFIDAGVWKSNLRQLARKRMEAHGWECDCIRCREVGMND
EDPDTVELNVDTYEAAGGTEHFISIEDFEKDLLVGFCRLRFPNDPVRAELEDAAIVRELH
VYGSEVGVGKQTDDGHQHEGHGRRLLSTAEALAADAGYDKLSVISGIGVRQYYREKLGYY
QDGPYVSTRLDQ
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgacaccgacgccgagtccgaggtcttcgagcgcgtctgtgagtcgctcgtc
gaggggattctcgacggcgacatcgacagagataatctcgaatcggccaagatggacgcc
tgccgcgagcactcctcgccgaaggtgccgaagaacacggatttgctcgactacgctccc
gaggagcaacgcgaagagcttgagtcggtgttgcagcgcaaaccggtccggacagcgtcc
ggcgtctcgccggttgctatcatgacctctccacacatgtgtccgcacgggaagtgtctc
tactgtccgggcggccccgcctcggagttttcgtcctcacagagctacaccggccacgaa
ccggcagcagcacggggcgtccagaacgattacgacccatacgggcaggtcacgctgcgt
ctccaccagctccgcgaaatcggccacccagtcgataaggtcgaactcatcctcatgggc
gggacgatgaccgcccggagccacgattatcaggagtggttcgtcaaacgcgccctcgaa
gcgatgaacgactacgacctcgacagcccgcctgcacccagcgaggaggactcgttcaag
cccgaccccgaggatgtcgacttccggtatctggaggatgtcatcgccgaaaacgagacg
gccaacatccgaaacatcggaacgaccttcgaaaccaagcccgactggtgtgaccccgag
cagatagaccggatgcttcggctcggcgggacgaaagtcgaagtcggcgtccagacgacc
tacgagcgcatcaaccgcgaaatgcaccggggccacggtgtccaggcctcgctggatgcc
aaccggcgactccgggacgccggcttcaaagtcggcttccacatgatgcccggccagccc
ggcatgtccaaagagatgtgtctacaggacttccgggagatcttcgagaacgccgactgg
cggccggactatctgaagatttatccgacgctcatcgtccgggatacggtgacctacgac
atgtggcggcgcgacgagtacgagccgctcaacaacgaggaggcggcggaactcgtcgcc
gaaatcaaatcgatgattccgcgctatacgcgcctccagcgcgtccagcgggatatcccg
gcagactttatcgatgccggggtctggaagtcgaacctccgacagctcgccagaaagcgg
atggaagcacacggctgggagtgtgactgtatccgctgtcgcgaggtcggtatgaacgac
gaagaccccgatactgtcgagctgaacgtcgacacctacgaggccgccggcgggacggaa
cacttcatctccatcgaggacttcgagaaggacctgctcgtcggcttctgccggctccgg
ttcccgaacgaccccgtcagggcggagttggaggacgcagcgattgtcagggagctccac
gtctacggcagcgaggtcggcgtcggcaagcagaccgacgatggccaccaacacgagggc
cacggtcggcggctgctgtcgacggccgaggcgctggctgcggacgccggctacgacaaa
ctctctgtcatctccggcatcggcgtccgccagtactatcgcgagaaactcggctactat
caggatggcccgtacgtctcgacgcggctggaccagtag

DBGET integrated database retrieval system